BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0524 (665 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 1.1 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 2.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 2.6 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 4.6 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 4.6 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 569 YHQCSILFLECLKLS*-CSHHKLGI*HEPLGCSAMLEEICKTFEKLLFSCDFVEML 405 YH ++L++ L L C+ H+ CS M+E + T + L+F + + L Sbjct: 115 YHDKTLLYMSKLTLVLSCAMKFESYPHDTQICSMMIESLSHTTQDLVFIWNMTDPL 170 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 259 RNIYCPWKMRIESKQGICNRALLWATVHAMTSL 357 R I CP R+ SKQ A W V T L Sbjct: 156 RTISCPIDGRLNSKQAAVIIAFTWFWVTPFTVL 188 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 259 RNIYCPWKMRIESKQGICNRALLWATVHAMTSL 357 R I CP R+ SKQ A W V T L Sbjct: 156 RTISCPIDGRLNSKQAAVIIAFTWFWVTPFTVL 188 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 100 FIHSTFLVNVIYI 138 FIHS FL+ +I+I Sbjct: 9 FIHSIFLILIIFI 21 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 100 FIHSTFLVNVIYI 138 FIHS FL+ +I+I Sbjct: 9 FIHSIFLILIIFI 21 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,399 Number of Sequences: 438 Number of extensions: 4584 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -