BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0523 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1... 26 5.9 SPAC227.07c |pab1||protein phosphatase regulatory subunit Pab1|S... 25 7.8 SPBC776.06c |||spindle pole body interacting protein |Schizosacc... 25 7.8 >SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1023 Score = 25.8 bits (54), Expect = 5.9 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 225 NASHCTTPQSPAPRRCSRSVYRDNFPTVRCRYSGESNSRI*R 350 NAS TTP +P S V +PT R + S I R Sbjct: 149 NASSYTTPMAPFTASFSNKVSHSAYPTRRLPSQAKKTSAIER 190 >SPAC227.07c |pab1||protein phosphatase regulatory subunit Pab1|Schizosaccharomyces pombe|chr 1|||Manual Length = 463 Score = 25.4 bits (53), Expect = 7.8 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 493 YLSGGDLSLGHYLLSASDHFSASVIGSPEQMLDL 392 Y+S DL + + LS SDH V PE M +L Sbjct: 191 YISADDLRINLWNLSISDHSFNIVDIKPENMEEL 224 >SPBC776.06c |||spindle pole body interacting protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 25.4 bits (53), Expect = 7.8 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = -2 Query: 471 HSVITFYPHLTTFQHPLSEVLSKCWIYFNLYLAPFRMPVFFFISGYLIRRYIDSVP 304 H+ +FY L+ L L+ W +FNLYL P I +I + ID++P Sbjct: 149 HNFQSFYQKLS-LDSSLILALNNFWSFFNLYLT--NSP---HIMNDIINKDIDNIP 198 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,920,691 Number of Sequences: 5004 Number of extensions: 62549 Number of successful extensions: 157 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -