BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0522 (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 21 6.8 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 21 6.8 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.8 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 9.0 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 265 RCIPLARQLTFSVNSFYVRLTILDELGLHRIRD 363 +C LAR V Y L I LG++R RD Sbjct: 485 KCERLARTEKLFVTPMYEGLLIDQSLGMNRRRD 517 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 265 RCIPLARQLTFSVNSFYVRLTILDELGLHRIRD 363 +C LAR V Y L I LG++R RD Sbjct: 485 KCERLARTEKLFVTPMYEGLLIDQSLGMNRRRD 517 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 265 RCIPLARQLTFSVNSFYVRLTILDELGLHRIRD 363 +C LAR V Y L I LG++R RD Sbjct: 485 KCERLARTEKLFVTPMYEGLLIDQSLGMNRRRD 517 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 265 RCIPLARQLTFSVNSFYVRLTILDELGLHRIRD 363 +C LAR V Y L I LG++R RD Sbjct: 485 KCERLARTEKLFVTPMYEGLLIDQSLGMNRRRD 517 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 96 HSYGPEKSTQVTIMPWVVT 152 H Y K+ QV +PW+V+ Sbjct: 300 HPYQMIKNQQVYDVPWIVS 318 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 96 HSYGPEKSTQVTIMPWVVT 152 H Y K+ QV +PW+V+ Sbjct: 300 HPYQMIKNQQVYDVPWIVS 318 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 453 QFYSDLFSLYRDNR 494 QF DLF YR N+ Sbjct: 168 QFIMDLFPFYRQNQ 181 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 Query: 185 NNDANDGHAYCGDDPRHN 132 N D H C DDP N Sbjct: 146 NVDGCQKHPLCNDDPNGN 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,292 Number of Sequences: 336 Number of extensions: 2459 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -