BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0522 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) 28 5.9 SB_37007| Best HMM Match : Oleosin (HMM E-Value=0.43) 28 7.8 >SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -3 Query: 452 SATENEIYVPPN*SRESR*LSKTTTKTNTASRILCKPSSSKIVSRT*KLLTENVS 288 S++E+E+YVP N + + + K TKT + S IVS ++ T V+ Sbjct: 722 SSSEHEVYVPNNPHKNNNRIKKNQTKTVNGLKEHVNGKLSPIVSPKDEISTGEVT 776 >SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) Length = 476 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = -3 Query: 305 LTENVSCLARGMHRECRRAVS-VR--CCQVTAGPGGCSHEELANNDANDGHAYC 153 + + + L G + +C R + +R CC V P + + + N GH YC Sbjct: 114 ICQTLEVLLLGFYPDCSRIMDDLRGMCCSVCYNPFHATESQAIPRNLNCGHTYC 167 >SB_37007| Best HMM Match : Oleosin (HMM E-Value=0.43) Length = 298 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 516 KNRNR*CYDYPDIAKTNLNKIVGNRERNLRP 424 +NRNR C+ YPD N NR R+ P Sbjct: 163 RNRNRDCHCYPDSRHGNDRNHGRNRNRDCHP 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,843,003 Number of Sequences: 59808 Number of extensions: 312237 Number of successful extensions: 724 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -