BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0522 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 7.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 7.9 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 Query: 210 PRPRGHLATPHRYRSTTL 263 P P GH +TP Y S L Sbjct: 126 PTPNGHPSTPIVYASCKL 143 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 433 ISFSVADNFIQICFRYIGIIVTSPITILYS 522 I FS F +IC R + V S + +YS Sbjct: 425 ILFSDVVTFTEICSRITPMEVVSMLNAMYS 454 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,252 Number of Sequences: 438 Number of extensions: 2820 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -