BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0517 (617 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5K897 Cluster: Putative uncharacterized protein; n=1; ... 33 7.2 UniRef50_A3ZX58 Cluster: Possible membrane fusion protein MtrC; ... 32 9.5 >UniRef50_Q5K897 Cluster: Putative uncharacterized protein; n=1; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 511 Score = 32.7 bits (71), Expect = 7.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 510 HIFKSIWLSFARLAFHCGFIFGQQYLTLYRRNIFSPTY 397 ++F+S+ L + RL FH G I Y + N+F+P Y Sbjct: 338 YVFQSVKLGYERLYFHQGTIGNSPYSWWGKSNVFAPYY 375 >UniRef50_A3ZX58 Cluster: Possible membrane fusion protein MtrC; n=1; Blastopirellula marina DSM 3645|Rep: Possible membrane fusion protein MtrC - Blastopirellula marina DSM 3645 Length = 427 Score = 32.3 bits (70), Expect = 9.5 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 419 EIFFLLPTPKVRFSSRCTGKKV*LFIPLYREESATFSPW 303 +++F LP P RF + G+K+ L +PL +E T PW Sbjct: 326 DLYFQLPNPNHRFQA---GQKIALHLPLTGDEMQTAIPW 361 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,211,314 Number of Sequences: 1657284 Number of extensions: 11181065 Number of successful extensions: 27497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27486 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44807090004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -