BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0517 (617 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr... 27 2.9 SPAC8F11.10c |pvg1|SPACUNK4.18|pyruvyltransferase |Schizosacchar... 25 6.6 >SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1225 Score = 26.6 bits (56), Expect = 2.9 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = -1 Query: 599 TTYRSPVSRAKTSKQYRVFALCFPTRFLGRIFLNQYGFLSLD*HSIAVSSSGNNILLYID 420 +T R S KTSK ++ L P+ + + GF+ D S ++ + +++D Sbjct: 880 STSRGSTS-VKTSKPKKISELLMPSEAVNAALDFESGFMGFDIISYKIAKPAQELAIFLD 938 Query: 419 EI 414 ++ Sbjct: 939 DL 940 >SPAC8F11.10c |pvg1|SPACUNK4.18|pyruvyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 401 Score = 25.4 bits (53), Expect = 6.6 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -1 Query: 470 HSIAVSSSG--NNILLYIDEIFFLLPTPKVRFSSRCT 366 + AV + G N +LL D +FF+ P P++R ++ T Sbjct: 222 YGFAVDAFGKHNEVLLTPDIVFFMGPIPEIREATPIT 258 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,452,242 Number of Sequences: 5004 Number of extensions: 48968 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -