BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0517 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2045| Best HMM Match : EGF (HMM E-Value=0) 31 0.99 SB_13756| Best HMM Match : Phospholip_A2_1 (HMM E-Value=2.1) 29 4.0 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 437 YCCPKMKPQWNASLAKESHIDLKICVRGIWSGNRAQTHG 553 YC P+ +N +S+ KIC R W+G+ +THG Sbjct: 368 YCIPR-DDNYNGHYTCDSNTGNKIC-RSYWTGSNCRTHG 404 >SB_13756| Best HMM Match : Phospholip_A2_1 (HMM E-Value=2.1) Length = 310 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 352 NFSSRCTGKKVQLFLPGF*QVPCALVSTSAL 260 +FS R TGK+ +LF F ++ C L+ T A+ Sbjct: 194 DFSYRFTGKESKLFCWHFMKICCVLIETQAI 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,377,226 Number of Sequences: 59808 Number of extensions: 354082 Number of successful extensions: 789 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -