BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0517 (617 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 31 0.46 At1g68120.1 68414.m07781 expressed protein 28 5.7 At4g19185.1 68417.m02831 integral membrane family protein contai... 27 10.0 At4g04330.1 68417.m00618 expressed protein 27 10.0 At3g52250.1 68416.m05742 myb family transcription factor contain... 27 10.0 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 31.5 bits (68), Expect = 0.46 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -3 Query: 513 THIFKSIWLSFARLAFHCGFIFGQQYLTLYRRNIFSPTYAESSVFIPLYRE 361 TH F ++ L+F LA FI+G +++ RR++ SPT S + + E Sbjct: 17 THFFFTV-LAFILLA---AFIYGHDFISFSRRSLHSPTIVHQSAIVVVVDE 63 >At1g68120.1 68414.m07781 expressed protein Length = 270 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 1 EYRAGVQERTLAGGREGGAPRTQKKNKL 84 E V+ R +GG+ GG P+ +K+ KL Sbjct: 116 EVDESVKRRHCSGGQRGGVPKVKKEKKL 143 >At4g19185.1 68417.m02831 integral membrane family protein contains Pfam profile:PF00892 integral membrane protein DUF6 Length = 398 Score = 27.1 bits (57), Expect = 10.0 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = -3 Query: 540 ALFPDQIPRTHIFKSIWLSFARLAFHCGFIFGQQYLTLYRRNIFSPTYA 394 A F ++ RT + KS+ LSF L +FG Q L L +PTYA Sbjct: 68 AYFRERKIRTPMNKSLLLSFFFLGL--AGVFGNQLLFLIGLTYTNPTYA 114 >At4g04330.1 68417.m00618 expressed protein Length = 174 Score = 27.1 bits (57), Expect = 10.0 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Frame = -2 Query: 412 FFSYLRRKFGFHPAV------QGRKCNFSSRCTGKKVQLFLPGF 299 + SYL KFG P V RKC + C+ K +++PGF Sbjct: 12 YLSYLNPKFGKRPLVSYPLMQSSRKCKQTRICSNK---MYVPGF 52 >At3g52250.1 68416.m05742 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 1677 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 485 ESHI-DLKICVRGIWSGNRAQTHGTALTSLLGLLVIC 592 + H+ ++ I G W GNR QT T+L LL C Sbjct: 1582 QQHLQNVPITSYGFWDGNRIQTGLTSLPESAKLLASC 1618 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,810,646 Number of Sequences: 28952 Number of extensions: 255982 Number of successful extensions: 575 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -