BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0514 (473 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribo... 119 1e-27 At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) 116 6e-27 At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) 112 1e-25 At4g35720.1 68417.m05069 expressed protein contains Pfam profile... 31 0.53 At1g79850.1 68414.m09328 30S ribosomal protein S17, chloroplast ... 31 0.53 At4g26980.1 68417.m03882 expressed protein 27 4.9 >At4g30800.1 68417.m04363 40S ribosomal protein S11 (RPS11B) ribosomal protein S11, Arabidopsis thaliana,PIR2:C35542 Length = 159 Score = 119 bits (286), Expect = 1e-27 Identities = 60/90 (66%), Positives = 67/90 (74%), Gaps = 5/90 (5%) Frame = +1 Query: 1 ADQTEKAFQKQATVFLNRKGGMKRK-----DMRHHKNVGLGFKTPREAIEGTYIDKKCPF 165 A+QTEKAF KQ VFL+ K K K R KN+GLGFKTPREAIEGTYID+KCPF Sbjct: 2 AEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIEGTYIDQKCPF 61 Query: 166 TGNVSIRGRILTGVVQKMKMQRTIVIRRDY 255 TG VSIRGRIL+G KMQRTI++RRDY Sbjct: 62 TGTVSIRGRILSGTCHSAKMQRTIIVRRDY 91 Score = 85.0 bits (201), Expect = 2e-17 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = +3 Query: 255 LHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 413 LH++ KY R+EKRH N+ H+SPCFR V+ GD VTIG+CRPLSKTVRFNVLKV Sbjct: 92 LHFVKKYRRYEKRHSNIPAHVSPCFR-VKEGDRVTIGQCRPLSKTVRFNVLKV 143 >At3g48930.1 68416.m05345 40S ribosomal protein S11 (RPS11A) Length = 160 Score = 116 bits (280), Expect = 6e-27 Identities = 58/90 (64%), Positives = 65/90 (72%), Gaps = 5/90 (5%) Frame = +1 Query: 1 ADQTEKAFQKQATVFLNRKGGMKRK-----DMRHHKNVGLGFKTPREAIEGTYIDKKCPF 165 A+QTEKAF KQ VFL+ K K K R KN+GLGFKTPREAI+G Y+DKKCPF Sbjct: 2 AEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCPF 61 Query: 166 TGNVSIRGRILTGVVQKMKMQRTIVIRRDY 255 TG VSIRGRIL G KMQRTI++RRDY Sbjct: 62 TGTVSIRGRILAGTCHSAKMQRTIIVRRDY 91 Score = 82.2 bits (194), Expect = 2e-16 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +3 Query: 255 LHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 413 LH++ KY R+EKRH N+ H+SPCFR V+ GD + IG+CRPLSKTVRFNVLKV Sbjct: 92 LHFVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHIIIGQCRPLSKTVRFNVLKV 143 >At5g23740.1 68418.m02784 40S ribosomal protein S11 (RPS11C) Length = 159 Score = 112 bits (270), Expect = 1e-25 Identities = 58/90 (64%), Positives = 65/90 (72%), Gaps = 5/90 (5%) Frame = +1 Query: 1 ADQTEKAFQKQATVFLNRK--GGMKRKDM---RHHKNVGLGFKTPREAIEGTYIDKKCPF 165 A+QTEKAF KQ VFL+ K G KR R KN+GLGFKTPREAI+G YID KCPF Sbjct: 2 AEQTEKAFLKQPKVFLSSKISGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYIDSKCPF 61 Query: 166 TGNVSIRGRILTGVVQKMKMQRTIVIRRDY 255 TG VSIRGRIL G KMQRTI++RR+Y Sbjct: 62 TGTVSIRGRILAGTCHSAKMQRTIIVRRNY 91 Score = 82.6 bits (195), Expect = 1e-16 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +3 Query: 255 LHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 413 LH++ KY R+EKRH N+ H+SPCFR V+ GD V IG+CRPLSKTVRFNVLKV Sbjct: 92 LHFVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHVIIGQCRPLSKTVRFNVLKV 143 >At4g35720.1 68417.m05069 expressed protein contains Pfam profile PF03087: Arabidopsis protein of unknown function Length = 325 Score = 30.7 bits (66), Expect = 0.53 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 43 FLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTG 171 FL+ G+K K+ HHK G+ K ++ IE + +K+ TG Sbjct: 203 FLSSPKGLKTKNHHHHKGWGIVMKLVKKGIEHHHQEKRDYETG 245 >At1g79850.1 68414.m09328 30S ribosomal protein S17, chloroplast / CS17 (RPS17) identical to 30S ribosomal protein S17, chloroplast precursor GB:P16180 [Arabidopsis thaliana] Length = 149 Score = 30.7 bits (66), Expect = 0.53 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 267 PKYNRFEKRHRNMSVHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 413 PKY R + + H P ++GD+V + + RP+SKT F L V Sbjct: 77 PKYKRRVRMKKKYQAH-DPD-NQFKVGDVVRLEKSRPISKTKSFVALPV 123 >At4g26980.1 68417.m03882 expressed protein Length = 343 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 112 KTPREAIEGTYIDKKCPFTGNVSIRGRILTGVVQK 216 + PREA+ +D+ PF ++ + ++TGVVQK Sbjct: 242 EVPREALPDVALDE--PFVKDIDPKTWVVTGVVQK 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,757,860 Number of Sequences: 28952 Number of extensions: 194077 Number of successful extensions: 445 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 439 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -