BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0513 (626 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 1.6 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 21 6.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 374 LNSDKGLFQSVERARVQHLLLNLGGVRAPRHQEELLFL 261 L+ K + Q V R + H LN+ VR+P +L L Sbjct: 335 LDEKKYILQEVVRVKKPHYELNMVEVRSPVTPADLRLL 372 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/43 (20%), Positives = 17/43 (39%) Frame = +1 Query: 25 TVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAE 153 T+S CK + H+ V F +++ ++ G E Sbjct: 31 TISQGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQGSSLTE 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,489 Number of Sequences: 336 Number of extensions: 2688 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -