BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0511 (669 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 25 2.9 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 5.0 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 23 6.6 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 8.7 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 8.7 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -2 Query: 380 VLLFSAYNKSRNSLPITVFHYKSRHIFFRKKQGPLADH 267 VLL + ++ L H+ R ++F +K PL+ H Sbjct: 89 VLLVTDLKLAKRILIEDFHHFPDRGVYFNEKDDPLSAH 126 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 245 FLNKNHHG 222 FLNKNHHG Sbjct: 143 FLNKNHHG 150 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = -1 Query: 432 TSYVERNL*SQSKKLLPCPPFFSIQQ---IEKF 343 + Y+E +Q +KL P PF Q IE+F Sbjct: 90 SDYIEEAYSAQQRKLYPADPFSKAQDRILIERF 122 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 542 PSGL*NMSFCKEVSFHQYSTTHSHRFCY 625 PSG+ + +F + H +T HR C+ Sbjct: 448 PSGIKSPAFKQPAFSHSVCSTEVHRSCF 475 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 542 PSGL*NMSFCKEVSFHQYSTTHSHRFCY 625 PSG+ + +F + H +T HR C+ Sbjct: 448 PSGIKSPAFKQPAFSHSVCSTEVHRSCF 475 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,953 Number of Sequences: 2352 Number of extensions: 11260 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -