BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0511 (669 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21321-6|AAG00046.1| 206|Caenorhabditis elegans Hypothetical pr... 28 6.9 AC006774-5|AAF60618.1| 363|Caenorhabditis elegans Hypothetical ... 28 6.9 >U21321-6|AAG00046.1| 206|Caenorhabditis elegans Hypothetical protein ZK177.3 protein. Length = 206 Score = 27.9 bits (59), Expect = 6.9 Identities = 21/68 (30%), Positives = 26/68 (38%) Frame = -2 Query: 356 KSRNSLPITVFHYKSRHIFFRKKQGPLADHK*NRSGIFLNKNHHGVHIDANDKHMADIRT 177 KSRN+L + V HY HI KQ L K + L K H + + Sbjct: 78 KSRNNLMVHVHHYHPTHI-NEMKQANLESAKEEKMKTMLEKQAKEAHEFEISQPAVFEKD 136 Query: 176 VLHYDQPM 153 YD PM Sbjct: 137 FASYDLPM 144 >AC006774-5|AAF60618.1| 363|Caenorhabditis elegans Hypothetical protein Y46H3A.4 protein. Length = 363 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 472 TRYQFFFFFWNWLHYYRLLVRP 537 T+Y+ F F +W YY LL P Sbjct: 233 TKYENFLVFLSWCFYYLLLTHP 254 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,096,002 Number of Sequences: 27780 Number of extensions: 285568 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -