BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0510 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.71 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 1.1 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 24 1.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 24 1.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 24 1.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 24 1.2 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 6.7 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.0 bits (52), Expect = 0.71 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 636 CPHRWIKIFSAVSLKSTLVTGYELSN 559 C HRW +I++ V ++ LV G ++ N Sbjct: 380 CEHRWRQIYNMVRFRN-LVKGTKIDN 404 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect(2) = 1.1 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +2 Query: 245 QALKTNINMECVWSMRECDGDERSHG 322 Q +K+N+ + +W+ + DE +G Sbjct: 71 QIMKSNVWLRFIWTDYQLQWDEADYG 96 Score = 20.6 bits (41), Expect(2) = 1.1 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +2 Query: 203 SQANFILKANIWL 241 ++ N I+K+N+WL Sbjct: 67 NEKNQIMKSNVWL 79 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 DLSSRHQRKGSCY-FICSTNIKLVCANYVVGRTPRRN 200 +L++ + G C FI ++ ++ VC NYV + P N Sbjct: 359 NLTAMNVWDGVCMCFIYASLLEFVCVNYVGRKRPMHN 395 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 DLSSRHQRKGSCY-FICSTNIKLVCANYVVGRTPRRN 200 +L++ + G C FI ++ ++ VC NYV + P N Sbjct: 328 NLTAMNVWDGVCMCFIYASLLEFVCVNYVGRKRPMHN 364 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 DLSSRHQRKGSCY-FICSTNIKLVCANYVVGRTPRRN 200 +L++ + G C FI ++ ++ VC NYV + P N Sbjct: 379 NLTAMNVWDGVCMCFIYASLLEFVCVNYVGRKRPMHN 415 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 93 DLSSRHQRKGSCY-FICSTNIKLVCANYVVGRTPRRN 200 +L++ + G C FI ++ ++ VC NYV + P N Sbjct: 328 NLTAMNVWDGVCMCFIYASLLEFVCVNYVGRKRPMHN 364 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 541 FPCIP*FYGVISEAETKSSGPLLAPETEFT 452 F +P VI+ +T + GPLLAP ++T Sbjct: 81 FNGVPSSLNVITN-KTGNGGPLLAPYPDWT 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,936 Number of Sequences: 438 Number of extensions: 4560 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -