BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0508 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 83 2e-16 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 81 1e-15 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 80 1e-15 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 79 4e-15 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 75 4e-14 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 75 4e-14 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 74 9e-14 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 9e-14 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 71 6e-13 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 67 1e-11 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 66 2e-11 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 66 3e-11 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 63 2e-10 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 61 6e-10 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 60 1e-09 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 55 4e-08 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 48 9e-06 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 42 4e-04 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 41 7e-04 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 40 0.002 SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 37 0.016 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 36 0.028 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 36 0.037 SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) 35 0.049 SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) 34 0.085 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 33 0.20 SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) 31 0.60 SB_1121| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 30 1.8 SB_56768| Best HMM Match : VWA (HMM E-Value=0.0042) 29 2.4 SB_57166| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-25) 29 3.2 SB_43289| Best HMM Match : DUF196 (HMM E-Value=5.5) 29 4.2 SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) 29 4.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_59600| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1.5e-05) 28 7.4 SB_45941| Best HMM Match : DUF632 (HMM E-Value=2.8) 28 7.4 SB_11986| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 7.4 SB_44021| Best HMM Match : DUF622 (HMM E-Value=0.34) 27 9.7 SB_42889| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 9.7 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_7999| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 87.0 bits (206), Expect = 1e-17 Identities = 37/64 (57%), Positives = 47/64 (73%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 YY+ILG+ K AS QE+K+AYKK K+HPDKN + +EKF +I EAYE L DP+KR + Sbjct: 5 YYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREIF 64 Query: 435 DLYG 446 D YG Sbjct: 65 DQYG 68 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 83.0 bits (196), Expect = 2e-16 Identities = 33/64 (51%), Positives = 48/64 (75%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 YY+ILG+ + AS ++IK+A++K+ VK+HPDKN + +EKF ++ EAYE L D KRR Y Sbjct: 27 YYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKDAEEKFREVAEAYEVLSDENKRRQY 86 Query: 435 DLYG 446 D +G Sbjct: 87 DQFG 90 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 80.6 bits (190), Expect = 1e-15 Identities = 33/64 (51%), Positives = 46/64 (71%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 YY +L + K AS +IK+AY+K +K+HPDKN + +EKF +I+EAYE L DP+K+ Y Sbjct: 5 YYAVLNVDKAASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSDPKKKEIY 64 Query: 435 DLYG 446 D YG Sbjct: 65 DQYG 68 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 80.2 bits (189), Expect = 1e-15 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 2/66 (3%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNP--NEAKQEKFLKITEAYETLKDPEKRR 428 YYE+LG+ + AS +++K+AY++ +++HPDKNP E +EKF K++EAYE L D EKR Sbjct: 5 YYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKRD 64 Query: 429 NYDLYG 446 YD YG Sbjct: 65 IYDKYG 70 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 78.6 bits (185), Expect = 4e-15 Identities = 33/66 (50%), Positives = 47/66 (71%) Frame = +3 Query: 249 RIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRR 428 R YY ILG+ + AS +IK+AY++ + FHPDKN N +EKF +I+EAY+ L DP +R Sbjct: 3 RNYYAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVLTDPRQRD 62 Query: 429 NYDLYG 446 +D+YG Sbjct: 63 IFDMYG 68 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 75.4 bits (177), Expect = 4e-14 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNYD 437 Y++LG+ + AS +IK+AY+KL + HPDKNP+ EKF IT AYE L DPEKR YD Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTG--EKFKDITFAYEILSDPEKRELYD 64 Query: 438 LYG 446 YG Sbjct: 65 RYG 67 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 75.4 bits (177), Expect = 4e-14 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNYD 437 Y++LG+ + AS +IK+AY+KL + HPDKNP+ EKF IT AYE L DPEKR YD Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTG--EKFKDITFAYEILSDPEKRELYD 64 Query: 438 LYG 446 YG Sbjct: 65 RYG 67 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 75.4 bits (177), Expect = 4e-14 Identities = 32/67 (47%), Positives = 48/67 (71%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKR 425 R+ YY+ILG+ A+ +EIK+AY +L K+HPD N +++ EKF +++EAYE L D KR Sbjct: 57 RKDYYKILGVPPNANQKEIKKAYFELAKKYHPDTNKDKSASEKFQEVSEAYEVLSDDGKR 116 Query: 426 RNYDLYG 446 + YD +G Sbjct: 117 KAYDSFG 123 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 74.1 bits (174), Expect = 9e-14 Identities = 30/64 (46%), Positives = 46/64 (71%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 YY+ILG+T+ A+ +IK+ Y+KL +K+HPDKN + + KF + EAY+ L DP+KR Y Sbjct: 5 YYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAIY 64 Query: 435 DLYG 446 + +G Sbjct: 65 NQFG 68 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 74.1 bits (174), Expect = 9e-14 Identities = 31/79 (39%), Positives = 53/79 (67%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 YYE+LG+ + A+T +I++AY++L +K+HPDK N +E F +++EAYE L DP++R + Sbjct: 5 YYEVLGVERNATTDDIRRAYRRLALKYHPDK--NAGTEENFKEVSEAYEVLCDPQQRERF 62 Query: 435 DLYGSYTTYSRKYDYKSQS 491 D + T+ Y ++ S Sbjct: 63 DKKFAPDTFRYSYSKRATS 81 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 71.3 bits (167), Expect = 6e-13 Identities = 30/61 (49%), Positives = 46/61 (75%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 YY+IL + A+ EIK++Y+KL +K+HPDKNP+E ++F +I++AYE L D +KR+ Y Sbjct: 66 YYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEG--DRFKQISQAYEVLSDEKKRKIY 123 Query: 435 D 437 D Sbjct: 124 D 124 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 71.3 bits (167), Expect = 6e-13 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +3 Query: 249 RIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAK-QEKFLKITEAYETLKDPEKR 425 R +Y ILG+ + AS +IK+AY+KL +K HPDKN ++ K QEKF I AYE L D ++R Sbjct: 24 RDFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQR 83 Query: 426 RNYDLYG 446 + YD G Sbjct: 84 KIYDQRG 90 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 6/70 (8%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEK------FLKITEAYETL 407 R+ YY+IL I+K AS EIK+AYKK +K HPD++ + ++K F ++ EAY L Sbjct: 157 RKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSIL 216 Query: 408 KDPEKRRNYD 437 DP+K+R YD Sbjct: 217 SDPKKKRRYD 226 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 6/70 (8%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEK------FLKITEAYETL 407 R+ YY+IL I+K AS EIK+AYKK +K HPD++ + ++K F ++ EAY L Sbjct: 157 RKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSIL 216 Query: 408 KDPEKRRNYD 437 DP+K+R YD Sbjct: 217 SDPKKKRRYD 226 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 66.1 bits (154), Expect = 2e-11 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 6/92 (6%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEK-FLKITEAYETLKDPEK 422 ++ +YEIL + K AS EIK A+ K +FHPD NP++ K F+K++EAY TL + Sbjct: 6 KKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSAR 65 Query: 423 RRNYD--LYGSY-TTY--SRKYDYKSQSEYDH 503 R+ YD L S+ +TY + Y S S + H Sbjct: 66 RQQYDARLNSSFASTYRPATASTYSSSSPFGH 97 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 66.1 bits (154), Expect = 2e-11 Identities = 37/92 (40%), Positives = 54/92 (58%), Gaps = 6/92 (6%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEK-FLKITEAYETLKDPEK 422 ++ +YEIL + K AS EIK A+ K +FHPD NP++ K F+K++EAY TL + Sbjct: 67 KKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSAR 126 Query: 423 RRNYD--LYGSY-TTY--SRKYDYKSQSEYDH 503 R+ YD L S+ +TY + Y S S + H Sbjct: 127 RQQYDARLNSSFASTYRPATASTYSSSSPFGH 158 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 66.1 bits (154), Expect = 2e-11 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 3/67 (4%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPD--KNPNEAKQEK-FLKITEAYETLKDP 416 +R YY+ILG+ + + +EI +AY+KL VK+HPD K ++ K EK F+ I A E L DP Sbjct: 206 KRDYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDP 265 Query: 417 EKRRNYD 437 EKR YD Sbjct: 266 EKRAKYD 272 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/55 (52%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNP--NEAKQEKFLKITEAYETLKD 413 YY+IL + + AS Q+IK++Y+KL +K+HPDKNP E + KF +I+EAYE L D Sbjct: 4 YYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD 58 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 64.9 bits (151), Expect = 5e-11 Identities = 27/66 (40%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = +3 Query: 246 RRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEK--FLKITEAYETLKDPE 419 RR +YE+LG+ + +K+ Y+KL +K+HPDKN + A++ F +I +AY+ L DP+ Sbjct: 2 RRCHYEVLGVERDVDDSALKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQ 61 Query: 420 KRRNYD 437 +R YD Sbjct: 62 ERAFYD 67 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 62.9 bits (146), Expect = 2e-10 Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 5/87 (5%) Frame = +3 Query: 192 NVKTSIYRDSP----YRSG*PHRRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNP-N 356 N+K S+ +D+ Y + ++ YY +LG++ +AS +IK AY KL +K HPD++ + Sbjct: 48 NLKRSLLKDAVWSRCYANKPGSKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGS 107 Query: 357 EAKQEKFLKITEAYETLKDPEKRRNYD 437 + K E F +I EAY L + E R+ YD Sbjct: 108 DKKHEVFQEIAEAYSVLGNLESRKQYD 134 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 62.9 bits (146), Expect = 2e-10 Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 5/87 (5%) Frame = +3 Query: 192 NVKTSIYRDSP----YRSG*PHRRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNP-N 356 N+K S+ +D+ Y + ++ YY +LG++ +AS +IK AY KL +K HPD++ + Sbjct: 48 NLKRSLLKDAVWSRCYANKPGSKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGS 107 Query: 357 EAKQEKFLKITEAYETLKDPEKRRNYD 437 + K E F +I EAY L + E R+ YD Sbjct: 108 DKKHEVFQEIAEAYSVLGNLESRKQYD 134 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 61.3 bits (142), Expect = 6e-10 Identities = 23/61 (37%), Positives = 41/61 (67%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 +Y++LG+ A+ EI++AY+++ ++ HPD+N + + KF K+ E LKD +KR+ Y Sbjct: 2484 FYQVLGVETTATQAEIRRAYRRISLQLHPDRNKEDDAELKFRKLVAVAEVLKDEDKRKRY 2543 Query: 435 D 437 D Sbjct: 2544 D 2544 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 60.1 bits (139), Expect = 1e-09 Identities = 27/62 (43%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAK-QEKFLKITEAYETLKDPEKRRN 431 YY+ LG+ K ++ +EI +AY+K +K HPDKNP+ K E F K+++A E L DP+ R Sbjct: 8 YYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVLTDPKARAA 67 Query: 432 YD 437 ++ Sbjct: 68 FN 69 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 57.6 bits (133), Expect = 8e-09 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHPDKNPN--EAKQEKFLKITEAYETLKDPEKRR 428 Y +LG+T+ A+ +EIK+ YKKL +K+HPD++ + E Q+ F++I EAYE L + +R Sbjct: 796 YRVLGLTEDATQEEIKKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKR 854 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 57.2 bits (132), Expect = 1e-08 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHP---DKNPNEAKQEKFLKITEAYETLKDPEKRR 428 Y++LG++K AS EIK+AY+K+ ++ HP DK E KF ++++Y L D EKR Sbjct: 17 YDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRA 76 Query: 429 NYDLYG 446 YD G Sbjct: 77 IYDESG 82 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/80 (35%), Positives = 44/80 (55%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 +Y+++ + A+ +EIK AY +L +HPD N + +E+F ++T AY TL E RR Y Sbjct: 52 HYDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREY 111 Query: 435 DLYGSYTTYSRKYDYKSQSE 494 D +R KS+ E Sbjct: 112 DKQIGTYYMTRSLTRKSEGE 131 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/80 (35%), Positives = 44/80 (55%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNY 434 +Y+++ + A+ +EIK AY +L +HPD N + +E+F ++T AY TL E RR Y Sbjct: 199 HYDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREY 258 Query: 435 DLYGSYTTYSRKYDYKSQSE 494 D +R KS+ E Sbjct: 259 DKQIGTYYMTRSLTRKSEGE 278 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 48.0 bits (109), Expect = 6e-06 Identities = 17/32 (53%), Positives = 28/32 (87%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKN 350 YYE+ GI++ A+++EI++A+KKL ++ HPDKN Sbjct: 29 YYELFGISRDATSKEIRKAFKKLALRLHPDKN 60 Score = 29.1 bits (62), Expect = 3.2 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 Query: 593 FINFYSPFCPPCQNI 637 F++F++P+CPPC + Sbjct: 306 FVDFFAPWCPPCMRL 320 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/55 (40%), Positives = 34/55 (61%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEK 422 Y +L I + AS EI++ Y+ L K+HPDK + + KF++I +AYE + D K Sbjct: 1250 YAVLEIDRGASVAEIRRQYRSLSKKYHPDKETGDPR--KFMRIAKAYEAVSDFNK 1302 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKD 413 YY +L + K+A+ E+K AY++L V +HPDK+ + K+ K+ L++ Sbjct: 132 YYAVLAVRKEANEDELKAAYRRLCVLYHPDKHTDPEKKRVCAKLVWCLPELEE 184 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/41 (46%), Positives = 26/41 (63%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKF 377 +YE LGI + A+ +I +AYKKL V HPDK+ +E F Sbjct: 144 HYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAF 184 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 255 YYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEA-KQEKFLKITEAYETLKDPEKRRN 431 +Y +L + A+ ++I +KK ++HPDK N+ E F ++ +A + L D + R Sbjct: 289 FYSLLDCGEYATNEQINTEFKKKAKEWHPDKKRNDTDSHEYFARLKKARDVLCDEKMRAK 348 Query: 432 YD 437 YD Sbjct: 349 YD 350 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 41.1 bits (92), Expect = 7e-04 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 8/73 (10%) Frame = +3 Query: 258 YEILGI----TKQASTQEIKQAYKKLVVK----FHPDKNPNEAKQEKFLKITEAYETLKD 413 YEILG+ ++ S E+K+ KK K +HPDKN +A+Q + I AY L+D Sbjct: 133 YEILGLDMKTARKLSKDELKKTLKKACRKQLLIWHPDKNGGDAEQAR--NIIMAYSCLED 190 Query: 414 PEKRRNYDLYGSY 452 E R Y+ Y Sbjct: 191 DETRARYNNQADY 203 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHPDK 347 Y ILG+ +AS +IK+ Y+KL V HPDK Sbjct: 802 YSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_8534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 926 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 258 YEILGITK-QASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETL 407 Y +LG+ K + + + ++AY KL ++HPD + A E+F I AY + Sbjct: 391 YMLLGLEKGKTGSVDAREAYLKLAKQYHPDSGKSTADGERFAMIEHAYRVV 441 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 264 ILGITKQASTQEIKQAYKKLVVKFHPDK 347 ILG+ +AS +IK+ Y+KL V HPDK Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 35.9 bits (79), Expect = 0.028 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +3 Query: 369 EKFLKITEAYETLKDPEKRRNYD 437 +KF I AYETLKDPE+R +YD Sbjct: 81 KKFQLIATAYETLKDPEQRNDYD 103 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 35.5 bits (78), Expect = 0.037 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = +3 Query: 249 RIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKF 377 + +Y+++ + A+ +EIK AY +L +HPD N + +E+F Sbjct: 74 KYHYDVMKLLPTATLREIKSAYYELSRIYHPDLNSSAEARERF 116 >SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) Length = 271 Score = 35.1 bits (77), Expect = 0.049 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 539 VDTLSGSSFYNYLNEGFH-FINFYSPFCPPCQN 634 V L GS F+ YLN H + FY+P+C C+N Sbjct: 149 VKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKN 181 >SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) Length = 186 Score = 34.3 bits (75), Expect = 0.085 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 512 KGLYHNDPFVDTLSGSSFYNYLNEGFHFINFYSPFCPPC 628 +GL ++ V L+ ++F ++ G HF+ FY+P+C C Sbjct: 83 EGLSTSEAGVHILTKNTFDKHIELGLHFVKFYAPWCIHC 121 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Frame = +3 Query: 264 ILGITKQASTQEIKQAYKKLVVKFHPDK--------NPNEAKQEKFLKITEAYETLK 410 +LG+ IK+AY+KL+ + HPDK E ++K +I +AYE +K Sbjct: 79 VLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIK 135 >SB_407| Best HMM Match : DnaJ (HMM E-Value=0.0039) Length = 106 Score = 31.5 bits (68), Expect = 0.60 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 297 EIKQAYKKLVVKFHPDKNPN 356 +I++AY +L K+HPDKNP+ Sbjct: 85 KIRKAYFRLAQKYHPDKNPD 104 >SB_1121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 31.1 bits (67), Expect = 0.79 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 522 YSPLYTNDHIPTEIYNHIFLNKLCMIHTNHN 430 YSPL+T+D IPT Y H+ +HT+H+ Sbjct: 89 YSPLHTHDSIPTPTYPHL------RLHTHHS 113 >SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/43 (34%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +3 Query: 297 EIKQAYKKLVVKFHPDK---NPNEA-KQEKFLKITEAYETLKD 413 ++K+AY+K V+ HPDK P+EA + F+++ EA+ ++ Sbjct: 484 DVKKAYRKAVLCVHPDKLTGEPHEALARAIFMELNEAWSLFEE 526 >SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) Length = 396 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 258 YEILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKI 386 Y+IL I K+ + +E+++ + VV+ P K AKQ K ++ Sbjct: 251 YQILHIAKKINAKELEELKQGDVVRLQPTKTVGRAKQWKQARV 293 >SB_56768| Best HMM Match : VWA (HMM E-Value=0.0042) Length = 815 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 193 FRFVKSDLQMRFKNQLNYRTHLL*KCLDVNSKTCLMTDI 77 F V +DL M F Q + +L +C D+ S TCL+ D+ Sbjct: 639 FGVVAADLTMEFF-QTMVKMYLGIRCKDITSTTCLLVDV 676 >SB_57166| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-25) Length = 382 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 204 SIYRDSPYRSG*PHRRIYYEILGITKQASTQEIKQAYKKLVVKFHPDKNP 353 ++ R YR+ HRRI E LGI A I ++ ++FHP + P Sbjct: 143 AVTRPLQYRATFHHRRIIMEALGIWSAAVLTNIILLFE---LEFHPQREP 189 >SB_43289| Best HMM Match : DUF196 (HMM E-Value=5.5) Length = 240 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +3 Query: 303 KQAYKKLVVKFHPDKNPNEAK 365 ++ K+L +K+HPDKNP++ + Sbjct: 216 RKIIKRLFLKWHPDKNPDDVE 236 >SB_29730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4275 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +3 Query: 303 KQAYKKLVVKFHPDKNPNEAK 365 ++ K+L +K+HPDKNP++ + Sbjct: 4044 RKIIKRLFLKWHPDKNPDDVE 4064 >SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1644 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +3 Query: 303 KQAYKKLVVKFHPDKNPNEAK 365 ++ K+L +K+HPDKNP++ + Sbjct: 1390 RKIIKRLFLKWHPDKNPDDVE 1410 >SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) Length = 1716 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 300 IKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNYDL 440 +K+ Y+ L K +K E+ K+ AY+ L+D +RR ++L Sbjct: 1566 LKRDYQSLKEKSETEKREFRQMYEEQKKVANAYQKLEDRYRRRVHEL 1612 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYGSYTTYSRKYDYKSQSEYDHLYIKDCTIMIHL 539 QEK K E E L+ EKR+ YG+ + ++E + L I I +HL Sbjct: 483 QEKITKAEEYLERLESNEKRKQEGTYGNDKETYENDEETYENEEEDLEIPVDFISVHL 540 >SB_59600| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1.5e-05) Length = 1119 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 530 DPFVDTLSGSSFYNYLNEGFHFINFYSPFCPPC 628 D F D+L+ S + L+E F++IN+YS C Sbjct: 39 DFFYDSLADSPQFASLDELFNYINYYSSLEDDC 71 >SB_45941| Best HMM Match : DUF632 (HMM E-Value=2.8) Length = 688 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +3 Query: 333 FHPDKNPNEAKQEKFLKITEAYETLKDPEKRRNYDLYGSYTTYSRKYDYKSQSEYDHLYI 512 FHP + ++E K E + +PE NY Y SR + ++++D + Sbjct: 623 FHPSPDSAHLRREDTSKSAEWFNMSFEPETGSNYTASDLYQGLSRISESSLETKFDEVGN 682 Query: 513 KD 518 +D Sbjct: 683 RD 684 >SB_11986| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 421 Score = 27.9 bits (59), Expect = 7.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 587 FHFINFYSPFCPPCQN 634 F FI+F++PFCP N Sbjct: 253 FSFISFFAPFCPDTSN 268 >SB_44021| Best HMM Match : DUF622 (HMM E-Value=0.34) Length = 572 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 2/75 (2%) Frame = +3 Query: 255 YYEILGITKQA--STQEIKQAYKKLVVKFHPDKNPNEAKQEKFLKITEAYETLKDPEKRR 428 Y+E+ G + Q K KK V ++ + + Q K L+ EA ET + +K Sbjct: 66 YFEVKGENSRLIRQVQHSKNGSKKRVQAVQ--EHIDSSAQVKLLR--EALETAEKEKKEL 121 Query: 429 NYDLYGSYTTYSRKY 473 L S+T Y KY Sbjct: 122 QEKLSNSFTAYKEKY 136 >SB_42889| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 336 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 264 ILGITKQASTQEIKQAYKKLVVKFHPDKNPNEAKQEKFLK 383 I G+T +A QE K +K ++ NP + QE L+ Sbjct: 296 IYGVTSRAFRQEYKAMFKMIISCGRASSNPGHSGQESQLE 335 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 396 YETLKDPEKRRNYDLYGS--YTTYSRKYDYKSQSEYDHLY 509 Y+T + + YD+ + Y T S +YD S ++YD Y Sbjct: 113 YDTTQYDTRSTRYDIVSTTQYNTRSTRYDIVSTTQYDTRY 152 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 303 KQAYKKLVVKFHPDKNP 353 K+ K+L +++HPDKNP Sbjct: 4242 KKVMKRLFLRWHPDKNP 4258 >SB_7999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 Query: 396 YETLKDPEKRRNYDLYGSYTTYSRKYDYKSQSEYDHLYIKDCTIMIH 536 Y T+ E RN D Y T S Y Y S+ + + C+ + H Sbjct: 4 YNTINSKEPVRNVDEYKINQTESLVYTYNSEEHTADVILLPCSSVSH 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,373,234 Number of Sequences: 59808 Number of extensions: 338353 Number of successful extensions: 859 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -