BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0508 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 33 0.008 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 33 0.008 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 33 0.008 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 33 0.008 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 33 0.008 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 33 0.008 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 33 0.008 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 33 0.010 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 33 0.010 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 33 0.010 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 33 0.010 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 33 0.010 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 25 2.0 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 24 4.7 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 8.2 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 3 ETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +3 Query: 366 QEKFLKITEAYETLKDPEKRRNYDLYG 446 + +F++I ++YE L D E+RR +D YG Sbjct: 3 ETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 32.7 bits (71), Expect = 0.010 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 372 KFLKITEAYETLKDPEKRRNYDLYG 446 +F++I ++YE L D E+RR +D YG Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQYG 26 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 363 KQEKFLKITEAYETLKDPEKRRNYDLYGSYTT 458 ++ K K T AY TL + DLY S TT Sbjct: 246 RRHKLSKCTAAYRTLYHCFRDDQLDLYASLTT 277 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 402 TLKDPEKRRNYDLYGSYTTYSRKYDYKSQSEYDHL 506 +LK P + D+ G+ YSR + +DHL Sbjct: 727 SLKHPPSHISIDVRGTAVPYSRSIKHLGVLVHDHL 761 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 393 AYETLKDPEKRRNYDL 440 AY+T + P+KRR Y L Sbjct: 301 AYDTPEFPDKRREYKL 316 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,447 Number of Sequences: 2352 Number of extensions: 12170 Number of successful extensions: 59 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -