BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0506 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 60 1e-09 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 59 3e-09 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 55 6e-08 SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 51 9e-07 SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) 50 1e-06 SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) 50 1e-06 SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) 49 3e-06 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 48 6e-06 SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 48 9e-06 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 46 2e-05 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 45 5e-05 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 44 8e-05 SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 1e-04 SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) 44 1e-04 SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 44 1e-04 SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 43 2e-04 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 43 2e-04 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 43 2e-04 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) 42 6e-04 SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) 42 6e-04 SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) 40 0.002 SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 40 0.002 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) 36 0.028 SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) 35 0.049 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_30894| Best HMM Match : BTB (HMM E-Value=3.1e-14) 35 0.049 SB_27263| Best HMM Match : Kelch_1 (HMM E-Value=2.10055e-42) 35 0.049 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) 32 0.45 SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_34106| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.1e-10) 31 0.60 SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) 31 0.79 SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) 31 1.0 SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) 31 1.0 SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) 31 1.0 SB_1012| Best HMM Match : ORC6 (HMM E-Value=2.9) 30 1.4 SB_6324| Best HMM Match : MCM (HMM E-Value=0) 29 2.4 SB_24335| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 28 5.6 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 28 5.6 SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) 28 5.6 SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_3393| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=0.012) 28 7.4 SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) 28 7.4 SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) 28 7.4 SB_38099| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_21588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) 27 9.7 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 2/82 (2%) Frame = +3 Query: 273 LASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFA 446 L L QR+ LCDV L + AH+ +LSACS YF+++F N +I++K + Sbjct: 22 LNQLRQRKELCDVELCVGNVQISAHRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDET 81 Query: 447 EMKSLLDFMYKGEVNVGQNMLQ 512 ++ L+DF Y G+ + Q +Q Sbjct: 82 ALQLLVDFAYTGKAEITQENVQ 103 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 59.3 bits (137), Expect = 3e-09 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 2/92 (2%) Frame = +3 Query: 243 EQPPNNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHP 416 ++ P D L +L Q E LCDV + T+ AH+ +L+ACSPYF ++F + Sbjct: 39 DRHPKQTLDSLEALRQCEELCDVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQA 98 Query: 417 IIFLKDVRFAEMKSLLDFMYKGEVNVGQNMLQ 512 I ++DV + M L+ F Y + + + +Q Sbjct: 99 EITIRDVDESAMNLLITFAYTASITIEETNVQ 130 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 54.8 bits (126), Expect = 6e-08 Identities = 25/101 (24%), Positives = 54/101 (53%), Gaps = 2/101 (1%) Frame = +3 Query: 252 PNNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIF 425 P+ +L LL++E LCDVT+ ++ H+ +L++CS YF S+F + +I Sbjct: 17 PSQAFTILTQLLEQEKLCDVTIKAGERKIRCHRVVLASCSAYFHSMFTNSMLESSQEVIT 76 Query: 426 LKDVRFAEMKSLLDFMYKGEVNVGQNMLQCS*KLQKVYKLE 548 ++ + + L++FMY ++ + + ++ V++L+ Sbjct: 77 IQGLSEKSVIQLINFMYTRKITITIDNIESLLTASAVFQLD 117 >SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%) Frame = +3 Query: 255 NNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFL--QNSHPHPIIFL 428 N V+ SL Q+ LCDV L + AH+ +L++ SPYF ++F + ++ L Sbjct: 25 NKAFQVMNSLRQQNMLCDVVLKAGSIEIPAHRVVLASSSPYFFAMFTGELSESRQTVVTL 84 Query: 429 KDVRFAEMKSLLDFMYKGEVNVGQNMLQ 512 K++ ++ L++F+Y E+ V ++ +Q Sbjct: 85 KEIDSLALELLIEFVYIAEIEVTEDNVQ 112 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 51.6 bits (118), Expect = 5e-07 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 2/73 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCDV L D E + +H+ +L+A SPYF ++F N I L D+ ++ ++++ Sbjct: 32 LCDVLLCVDDEEIPSHKLVLAASSPYFRAMFTSNLLECTQRTITLYDIDVGALQQIVEYF 91 Query: 474 YKGEVNVGQNMLQ 512 Y G++ + ++ +Q Sbjct: 92 YTGKITIDEDNVQ 104 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCDVTL +G+ AH+ +L+A S YF +F P + L+++R + M +L ++ Sbjct: 29 LCDVTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYL 88 Query: 474 YKGEVNV 494 Y GE+ V Sbjct: 89 YTGEITV 95 >SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 548 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 4/82 (4%) Frame = +3 Query: 261 LTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESI----FLQNSHPHPIIFL 428 L L + LC+VT+ +G+ AH+ +L+A SPYF ++ F + + P+I L Sbjct: 36 LMQCLNDFRKHNVLCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVI-L 94 Query: 429 KDVRFAEMKSLLDFMYKGEVNV 494 +++ M+ LL+F+Y G + + Sbjct: 95 ENITADVMEELLNFIYAGTIKI 116 >SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 570 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 4/82 (4%) Frame = +3 Query: 261 LTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESI----FLQNSHPHPIIFL 428 L L + LC+VT+ +G+ AH+ +L+A SPYF ++ F + + P+I L Sbjct: 36 LMQCLNDFRKHNVLCEVTIVVNGKPFYAHRNVLAAASPYFRAMFSSHFREQNESKPVI-L 94 Query: 429 KDVRFAEMKSLLDFMYKGEVNV 494 +++ M+ LL+F+Y G + + Sbjct: 95 ENITADVMEELLNFIYAGTIKI 116 >SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42) Length = 635 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/69 (33%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +3 Query: 297 ALCDVTLACDGETVKAHQTILSACSPYFESIF---LQNSHPHPIIFLKDVRFAEMKSLLD 467 +LCDV L +G T AH+ +L+A SP+F +F ++ + I+ LK V+ + M+++L+ Sbjct: 32 SLCDVDLMVEGLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIV-LKQVKASVMENVLE 90 Query: 468 FMYKGEVNV 494 ++Y G+ ++ Sbjct: 91 YLYTGKTSL 99 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +3 Query: 288 QREALCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSL 461 Q + LCDV L + E AH+ IL+A S YF ++F + + LK ++ + +K + Sbjct: 36 QSKILCDVVLLVENEEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEI 95 Query: 462 LDFMYKGEVNV 494 LDF+Y G + + Sbjct: 96 LDFLYTGRIEI 106 >SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = +3 Query: 258 NLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFL--QNSHPHPIIFLK 431 N+ + L +L Q +CDVT+ + +H+ IL+A S YF S+F + I LK Sbjct: 21 NVLETLRTLFQGRKMCDVTVVVGKMEIPSHRLILAANSSYFYSMFTSGMSETAQNRINLK 80 Query: 432 DVRFAEMKSLLDFMYKGEVNVGQNMLQ 512 +V ++ L+++ Y + + +N +Q Sbjct: 81 EVDATVVRQLIEYCYTSTIEINENNVQ 107 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 47.6 bits (108), Expect = 9e-06 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 3/100 (3%) Frame = +3 Query: 270 VLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIF---LQNSHPHPIIFLKDVR 440 V+ L R+ LCDVTL + AH+ +L++ S YF+++F L S + L+DV Sbjct: 36 VMDDLRGRKQLCDVTLCVGERQIVAHRLVLASFSSYFQAMFTGGLVESFEDSVT-LRDVD 94 Query: 441 FAEMKSLLDFMYKGEVNVGQNMLQCS*KLQKVYKLEV*QR 560 ++ L+DF Y G++++ +Q +++L Q+ Sbjct: 95 SGAVELLVDFAYTGKLDITTENVQSIMYASSLFQLNAIQK 134 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 3/83 (3%) Frame = +3 Query: 273 LASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIF---LQNSHPHPIIFLKDVRF 443 L L + +CD L + + H+ ++SA SPYFE +F L+ S+ + ++ + Sbjct: 24 LQHLRRLNTMCDAVLKVEEKQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVT-IQGIDS 82 Query: 444 AEMKSLLDFMYKGEVNVGQNMLQ 512 +LLDF+Y G +NV + +Q Sbjct: 83 ETFSALLDFIYTGVINVNEENVQ 105 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCDV L D ++ H+ +L++CS YF ++F II +KD+ M+ L++F Sbjct: 11 LCDVVLRIDEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFA 70 Query: 474 YKGEVNV 494 Y G V + Sbjct: 71 YTGRVEI 77 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 45.2 bits (102), Expect = 5e-05 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%) Frame = +3 Query: 297 ALCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDF 470 A+CDV + + AH+ ILSA S YF ++F N ++ + V M+S+L+F Sbjct: 32 AMCDVVIKAEDTEFLAHRNILSASSDYFFAMFNGNMKESSQDVVTITGVTPDSMRSILNF 91 Query: 471 MYKGEV 488 +Y GE+ Sbjct: 92 IYTGEI 97 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/45 (44%), Positives = 26/45 (57%) Frame = +3 Query: 255 NNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESI 389 N V L L DVTL GE +KAH+ +L+ACSPYF ++ Sbjct: 23 NEAFSVFKELRDDGELLDVTLHVQGEEIKAHRVVLAACSPYFRAM 67 >SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 651 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 2/91 (2%) Frame = +3 Query: 228 ILLALEQPPNNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSH 407 +L + P + L L E LCDVTL ++ +H+ +L+ SPYF ++ + Sbjct: 7 LLFCVPDFPTKVFSSLNELRSEEKLCDVTLVVKDRSLVSHRVVLAGWSPYFHAMLTGDML 66 Query: 408 PHPI--IFLKDVRFAEMKSLLDFMYKGEVNV 494 + + + + A ++ L++F Y G + Sbjct: 67 ESRLEKVTIHGIECAALEELINFCYTGRTEI 97 >SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHP--IIFLKDVRFAEMKSLLDFM 473 LCDVTL + AH+ IL+A SPYF ++F + I L +V M+ +L ++ Sbjct: 25 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 84 Query: 474 YKGEVNVGQN 503 Y G V V ++ Sbjct: 85 YSGSVVVEES 94 >SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 2/88 (2%) Frame = +3 Query: 255 NNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPI--IFL 428 N ++ L ++ LCDV L G + H+ +L+ S Y ++F + I L Sbjct: 14 NEALQMMNELRKKRELCDVLLHVGGREFRGHRIVLAGASSYLRAMFTNGMLESGMRDIKL 73 Query: 429 KDVRFAEMKSLLDFMYKGEVNVGQNMLQ 512 + + A M+ LLDF+Y G V++ +Q Sbjct: 74 QGIDPAVMEILLDFVYTGIVDISVENVQ 101 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHP--IIFLKDVRFAEMKSLLDFM 473 LCDVTL + AH+ IL+A SPYF ++F + I L +V M+ +L ++ Sbjct: 1394 LCDVTLNVNEVLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 1453 Query: 474 YKGEVNV 494 Y G V V Sbjct: 1454 YSGSVVV 1460 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 2/87 (2%) Frame = +3 Query: 258 NLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHP--HPIIFLK 431 ++ D L SL + LCD + G+T H+ +L A SP+F +F + I L+ Sbjct: 20 SILDRLNSLRKENVLCDAVIQIGGKTHPVHKNVLCAASPFFRGLFTNDMQEKNQEHIELQ 79 Query: 432 DVRFAEMKSLLDFMYKGEVNVGQNMLQ 512 + + ++ FMY G + V + Q Sbjct: 80 VISGDVGEEVISFMYTGAIKVEKENAQ 106 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 2/85 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCDV L + AH+ +L+ACS YF ++F I L+ ++ M+ L++F Sbjct: 41 LCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEFA 100 Query: 474 YKGEVNVGQNMLQCS*KLQKVYKLE 548 Y + V ++ +Q + +LE Sbjct: 101 YTARIQVSEDNVQALLPAASLLQLE 125 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 2/85 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCDV L + AH+ +L+ACS YF ++F I L+ ++ M+ L++F Sbjct: 41 LCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEFA 100 Query: 474 YKGEVNVGQNMLQCS*KLQKVYKLE 548 Y + V ++ +Q + +LE Sbjct: 101 YTARIQVSEDNVQALLPAASLLQLE 125 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 42.7 bits (96), Expect = 2e-04 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 5/81 (6%) Frame = +3 Query: 267 DVLASL--LQREA-LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLK 431 D+L S+ L+++ LCDV L + + AH+ +L++CS YF ++F + +I L+ Sbjct: 23 DILTSVNKLRKDGKLCDVVLQVEKKEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQ 82 Query: 432 DVRFAEMKSLLDFMYKGEVNV 494 + M+ LLDF+Y V + Sbjct: 83 GLASDTMEVLLDFVYTETVKL 103 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = +3 Query: 303 CDVTLAC-DGETVKAHQTILSACSPYFESIFL--QNSHPHPIIFLKDVRFAEMKSLLDFM 473 CDV L DG+ + AH+ +LSA S YF ++FL I ++ + M +L++F Sbjct: 26 CDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLVEFA 85 Query: 474 YKGEVNVGQNMLQ 512 Y V + ++ Sbjct: 86 YTSNVRINSENVE 98 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/81 (27%), Positives = 47/81 (58%), Gaps = 2/81 (2%) Frame = +3 Query: 258 NLTDVLASLLQREALCDVTLACDGETV-KAHQTILSACSPYFESIF-LQNSHPHPIIFLK 431 ++T L + E++CD+TL E + AH+ +L+A S YF+++F + + + Sbjct: 14 SVTSQLMQYQESESMCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISL 73 Query: 432 DVRFAEMKSLLDFMYKGEVNV 494 D+ +K++L ++Y G+V++ Sbjct: 74 DISTRTLKAILKYVYCGDVSL 94 >SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36) Length = 398 Score = 41.5 bits (93), Expect = 6e-04 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 3/100 (3%) Frame = +3 Query: 216 NGPAILLALEQPPNNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIF- 392 +G + AL+ P L+ + +LL D L G KAH+ IL+A SP F ++F Sbjct: 194 SGSSHSAALKVPECRLSSHMGNLLDNATFSDTVLIAGGREFKAHKAILAARSPVFSAMFE 253 Query: 393 --LQNSHPHPIIFLKDVRFAEMKSLLDFMYKGEVNVGQNM 506 ++ S + L D+ + +L F+Y G Q M Sbjct: 254 HEMEESRKGRVEIL-DIDPDVFQEMLKFVYTGNTPQIQGM 292 >SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42) Length = 603 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +3 Query: 303 CDVTLACDGETVKAHQTILSACSPYFESIFLQNSHP--HPIIFLKDVRFAEMKSLLDFMY 476 CDV L +G+ AH+ +L+A S +F ++F I L + + S+LDF Y Sbjct: 52 CDVNLEVEGQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSILDFFY 111 Query: 477 KGEVNVGQN 503 E+N+ ++ Sbjct: 112 TREINISRD 120 >SB_40807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = +3 Query: 246 QPPNNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPIIF 425 QP ++L LL+ DV L G A++ ILSA YF+ +F S+ P+ + Sbjct: 93 QPVSSLKKDFQELLENAYCSDVVLLYSGSRFHANKAILSARCSYFKDMFSDESN-QPLTY 151 Query: 426 LKDVRFAEMK-----SLLDFMYKGE 485 D+ E+ SLL ++Y G+ Sbjct: 152 SVDIPVEEISTGMFASLLQYLYTGD 176 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 336 VKAHQTILSACSPYFESIFLQNSHPHPII 422 V H+ +L A SPYF S+ L+ P++ Sbjct: 244 VPCHKAVLCARSPYFRSLLLKKDSSFPVL 272 >SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 6/85 (7%) Frame = +3 Query: 255 NNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPIIFLKD 434 + L L S E LCDVTL + + H+ +L+A SPYF +F+ + ++K+ Sbjct: 32 DELCAFLQSQRNDEVLCDVTLRHNERRIPCHKVVLAARSPYFRHLFINSESGQ---YVKN 88 Query: 435 VRFAEMKSLL------DFMYKGEVN 491 V S+L +++Y G+++ Sbjct: 89 VELPSYFSILAVDEVINYLYSGKLH 113 >SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 595 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN-SHPHPIIFLKDVRFAEMKSLLDFMY 476 L DV L DG AH+ IL+A S YF ++F + + + ++++ M+ LL F+Y Sbjct: 33 LTDVVLIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRTVVVQEITSTAMEVLLAFIY 92 Query: 477 KGEVNVGQNMLQ 512 +G++ + + ++ Sbjct: 93 QGKLLITEENVE 104 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/84 (22%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +3 Query: 270 VLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSH---PHPIIFLKDVR 440 VL + CD+TL + AH+ +L+A SPYF + L ++ + ++ Sbjct: 30 VLNEMRTNSEHCDITLKAGNLVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVMPDSLK 89 Query: 441 FAEMKSLLDFMYKGEVNVGQNMLQ 512 + ++L+F Y G + + ++ Sbjct: 90 PGAVVAMLEFFYSGTLQINLKSIE 113 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +3 Query: 303 CDVTLACDGETVKAHQTILSACSPYFESIFL--QNSHPHPIIFLKDVRFAEMKSLLDFMY 476 CDV L +G H+ +L+A SP+F ++F + L+ ++ M+S+L+F Y Sbjct: 56 CDVILQVEGRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQSIKAKAMESILEFFY 115 Query: 477 KGEVNVGQNML 509 E+ + ++ L Sbjct: 116 TQEIVLEEDEL 126 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/67 (23%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCD+ + + ++AH+ +L++ S YF ++F + + L D+ A +++L+ + Sbjct: 33 LCDIKIVIGDKRIRAHKLVLASFSDYFSAMFTGDMAETSQNTVHLTDMDPAAVQALISYS 92 Query: 474 YKGEVNV 494 Y E+ + Sbjct: 93 YTSEIEI 99 >SB_18446| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 571 Score = 35.9 bits (79), Expect = 0.028 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +3 Query: 300 LCDVTLACDGETVKAHQTILSACSPYFESIFLQN--SHPHPIIFLKDVRFAEMKSLLDFM 473 LCDV L AH+ +L A S +F +F + + LK M+ LL ++ Sbjct: 20 LCDVELIVGNNRFAAHKNVLCASSIFFNGLFSSSMRERQENTVNLKQFPVNIMEDLLTYL 79 Query: 474 YKGEVNVGQNMLQ 512 Y G++ V + Q Sbjct: 80 YTGKLEVTEATAQ 92 >SB_35938| Best HMM Match : BTB (HMM E-Value=8.5e-24) Length = 467 Score = 35.1 bits (77), Expect = 0.049 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = +3 Query: 324 DGETVK--AHQTILSACSPYFESIFLQN-SHPHPIIFLKDVRFAEMKSLLDFMYKGE-VN 491 DG V+ AH+ +LS SP FE++F N + P + L D + LL ++Y + V Sbjct: 37 DGTEVRFPAHKFVLSVSSPVFEAMFFGNLAESGPTVRLPDCTVDGFQELLRYLYCDQVVF 96 Query: 492 VGQNML 509 G+N+L Sbjct: 97 TGKNVL 102 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 35.1 bits (77), Expect = 0.049 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Frame = +3 Query: 261 LTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIF---LQNSHPHPIIFLK 431 L+ +L Q L DVT + AH+ IL+A S YF ++ ++ ++P I + Sbjct: 18 LSSQSGTLYQSRELTDVTFIVEKTKFTAHRVILAARSEYFRALLFGGMREANPGIEIEVA 77 Query: 432 DVRFAEMKSLLDFMYKGEV 488 D +LL ++Y G++ Sbjct: 78 DASSIAFDALLRYIYTGKM 96 >SB_30894| Best HMM Match : BTB (HMM E-Value=3.1e-14) Length = 159 Score = 35.1 bits (77), Expect = 0.049 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 276 ASLLQREALCDVTLACDGETVKAHQTILSACSPYF-ESIFLQNSHPHPIIFLK-DVRFAE 449 A L + LCDV + KAH I+S S YF + + + I LK + Sbjct: 35 AQLRKEHILCDVEVIVSDGVSKAHGVIISIGSEYFRDRLTAIACRENKRIELKYKITKGT 94 Query: 450 MKSLLDFMYKGEVNVGQN 503 ++++LDF+Y G + + ++ Sbjct: 95 LENVLDFLYSGNIKITES 112 >SB_27263| Best HMM Match : Kelch_1 (HMM E-Value=2.10055e-42) Length = 559 Score = 35.1 bits (77), Expect = 0.049 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 276 ASLLQREALCDVTLACDGETVKAHQTILSACSPYF-ESIFLQNSHPHPIIFLK-DVRFAE 449 A L + LCDV + KAH I+S S YF + + + I LK + Sbjct: 47 AQLRKEHILCDVEVIVSDGVSKAHGVIISIGSEYFRDRLTAIACRENKRIELKYKITKGT 106 Query: 450 MKSLLDFMYKGEVNVGQN 503 ++++LDF+Y G + + ++ Sbjct: 107 LENVLDFLYSGNIKITES 124 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 33.9 bits (74), Expect = 0.11 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +3 Query: 276 ASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFL----QNSHPH-PIIFLKDVR 440 A + + + DVT +GE H+ IL+ SP F+ + +NS H P I + D++ Sbjct: 481 ADYVNNQEMSDVTFVVEGEPFYGHKIILATASPRFKQMLTIKPSENSEGHVPCIEITDIK 540 Query: 441 F 443 + Sbjct: 541 Y 541 >SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +3 Query: 312 TLACDGETVKAHQTILSACSPYFESIFL 395 T + + T+ AHQTILSA SP F +FL Sbjct: 255 TFSGNAPTLHAHQTILSAASPIFRELFL 282 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 32.7 bits (71), Expect = 0.26 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 5/83 (6%) Frame = +3 Query: 273 LASLLQREALCDVTLACDG--ETVKAHQTILSACSPYFESIF--LQNSHPHPIIFLKDVR 440 L + +RE LCDV + D AH+ +L+A S YF ++ + L + Sbjct: 3573 LNEMRKREFLCDVIILADNGCRRFPAHRAVLAASSRYFHKLYNGTTLARYSRETILSGIC 3632 Query: 441 FAEMKSLLDFMYKGEVNV-GQNM 506 E+++++ ++Y EV + G N+ Sbjct: 3633 DRELETVVHYIYTSEVCIDGDNV 3655 >SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30) Length = 176 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 303 CDVTLACDGETVKAHQTILSACSPYFESIF---LQNSHPHPIIFLKDVRFAEMKSLLDFM 473 CDVTL ++ H+ +L+A S YF ++F S + ++ L D+ + +++ + Sbjct: 33 CDVTLKVTDQSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVV-LHDLDPKGVNAVISYF 91 Query: 474 YKGEVNV 494 Y ++ + Sbjct: 92 YNSKIEI 98 >SB_46137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 31.5 bits (68), Expect = 0.60 Identities = 22/84 (26%), Positives = 39/84 (46%) Frame = +3 Query: 243 EQPPNNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPII 422 E L ++L + CDV L + AH+ ILSA P S L + I Sbjct: 18 ENHEKRLLELLNEQRKATKFCDVLLEVGDSEIAAHRAILSASIPVL-SERLSDRKEGLKI 76 Query: 423 FLKDVRFAEMKSLLDFMYKGEVNV 494 L+ ++ +K+++D++Y ++V Sbjct: 77 KLEGLQHNAVKAIVDYLYTSCLDV 100 >SB_34106| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.1e-10) Length = 262 Score = 31.5 bits (68), Expect = 0.60 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 195 FTDISTNNGPAILLALEQPPNNLTDVLASLLQREALCDVTLACDGETVKAHQTILS 362 FTD+ N A L+ EQPP ++++ E+LC + E VK ++ +S Sbjct: 127 FTDLDYNTMMASLIGEEQPPLIAVSDTPAIMEVESLCSLIRGGVDEDVKYNEAYIS 182 >SB_32554| Best HMM Match : BTB (HMM E-Value=2e-13) Length = 133 Score = 31.1 bits (67), Expect = 0.79 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 324 DGETVK--AHQTILSACSPYFESIFL-QNSHPHPIIFLKDVRFAEMKSLLDFMYKGEV 488 DGE V AH+ +L+ SP FE++F + + I L D + + +L ++Y+ EV Sbjct: 4 DGEKVSIPAHKYVLATSSPVFEAMFFGKLAETSRNITLPDCFYEGVLEMLRYLYRDEV 61 >SB_13953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 30.7 bits (66), Expect = 1.0 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Frame = +3 Query: 324 DGETVK--AHQTILSACSPYFESIFL-QNSHPHPIIFLKDVRFAEMKSLLDFMYKGEVNV 494 DGE V AH+ +L+ SP FE++F + + I L D M +L F+Y E+ Sbjct: 35 DGEKVSIPAHKYVLATSSPVFEAMFFGKLAETGFTIALPDCSAEGMLEMLRFIYTEEIRF 94 Query: 495 GQNMLQCS*KLQKVYKLEV*QRTIH 569 N+ L K Y L + H Sbjct: 95 TINIAVEVLYLAKKYILPCLEERCH 119 >SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30) Length = 619 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 303 CDVTLACDGETVKAHQTILSACSPYFESIF 392 CDVTL ++ H+ +L+A S YF ++F Sbjct: 75 CDVTLKVTDQSFPGHKLVLAANSTYFRAMF 104 >SB_1926| Best HMM Match : PH (HMM E-Value=1.4e-23) Length = 998 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/42 (28%), Positives = 26/42 (61%) Frame = +3 Query: 255 NNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYF 380 + L +A L ++ D+T++ G+ +KAH+ +L+A S ++ Sbjct: 754 SRLLKTVADLYDKDLYSDITVSFGGQKIKAHKFVLAARSDHW 795 >SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) Length = 1774 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 491 CWPKYAPMFLKTAESLQVRGLTENNTLNPKSEERSTPVVGAEN 619 C P P T +S V LTEN++ +S STP G N Sbjct: 1383 CTPLTQPAITHTQQSGDVIDLTENDSSRDESSRESTPERGTRN 1425 >SB_1012| Best HMM Match : ORC6 (HMM E-Value=2.9) Length = 1108 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 268 MCLRVFCKERLSVMSLSLVMERQSRHTRQYYQHAHHILKAYSCKIRIHIPLYSLKMYDLQ 447 + L + CK+R+++ L ++ TR Y+ A HIL CK R+ IP+ L + + Sbjct: 66 LALHILCKQRMTIPVRRLTLDGM---TRVYHVLALHIL----CKQRMTIPVRKLTLEGMT 118 Query: 448 R 450 R Sbjct: 119 R 119 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 268 MCLRVFCKERLSVMSLSLVMERQSRHTRQYYQHAHHILKAYSCKIRIHIPLYSLKMYDLQ 447 + L + CK+R+++ L ++ TR Y+ A HIL CK R+ IP+ L + + Sbjct: 395 LALHILCKQRMTIPVRKLTLDGM---TRVYHALALHIL----CKQRMTIPVRRLTLDGMT 447 Query: 448 R 450 R Sbjct: 448 R 448 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 268 MCLRVFCKERLSVMSLSLVMERQSRHTRQYYQHAHHILKAYSCKIRIHIPLYSLKMYDLQ 447 + L + CK+R+++ L ++ TR Y+ A HIL CK R+ IP+ L + + Sbjct: 537 LALHILCKQRMTIPVRRLTLDGM---TRVYHVLALHIL----CKQRMTIPVRRLTLEGMT 589 Query: 448 R 450 R Sbjct: 590 R 590 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +1 Query: 268 MCLRVFCKERLSVMSLSLVMERQSRHTRQYYQHAHHILKAYSCKIRIHIPLYSLKMYDLQ 447 + L + CK+R+++ L +E TR Y+ A HIL CK R I + L + + Sbjct: 95 LALHILCKQRMTIPVRKLTLEGM---TRVYHAFALHIL----CKQRKTISVRRLTLDGMT 147 Query: 448 R 450 R Sbjct: 148 R 148 >SB_6324| Best HMM Match : MCM (HMM E-Value=0) Length = 1592 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 319 LVMERQSRHTRQYYQHAHHILKAYSCKIRIHIPLYS 426 L+ ERQ R RQ Q A KA S + H P+++ Sbjct: 1110 LLYERQRRRRRQQEQRARSREKASSANVERHFPIFT 1145 >SB_24335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 614 PRPPLASIALPTSDSMYCS 558 P PP++S ALP SD++ C+ Sbjct: 86 PSPPVSSAALPNSDNLVCN 104 >SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +3 Query: 255 NNLTDVLASLLQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPIIFLKD 434 N + L L+ DV G+ AH+ IL+ S YF S+F +I LK+ Sbjct: 74 NPYYEFLRRTLESGDFADVCFVIHGQRFCAHRAILTTRSSYFASMFETKWKDKHVITLKN 133 >SB_58957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 285 LQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPI--IFLKDVRFAEMKS 458 L + L D+T G +V AH+ +L S ++ + + I L DV A Sbjct: 65 LNKALLSDITFVVKGVSVPAHRVVLITRSAVMAAMLDGKFRENDLAMIELPDVPLAPFLI 124 Query: 459 LLDFMYKGEVNV 494 LL+++Y N+ Sbjct: 125 LLEYIYTDSCNL 136 >SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 285 LQREALCDVTLACDGETVKAHQTILSACSPYFESIFLQNSHPHPI--IFLKDVRFAEMKS 458 L + L D+T G +V AH+ +L S ++ + + I L DV A Sbjct: 287 LNKALLSDITFVVKGVSVPAHRVVLITRSAVMAAMLDGKFRENDLAMIELPDVPLAPFLI 346 Query: 459 LLDFMYKGEVNV 494 LL+++Y N+ Sbjct: 347 LLEYIYTDSCNL 358 >SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) Length = 414 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 326 WRDSQGTPDNIISMLTIF*KHIPAKFASTSHYI 424 +R QGT D+I ++ ++ KH+ AK T++++ Sbjct: 60 FRKEQGTIDSIFALKSLIDKHVKAKPQKTNNFL 92 >SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) Length = 189 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 326 WRDSQGTPDNIISMLTIF*KHIPAKFASTSHYI 424 +R QGT D+I ++ ++ KH+ AK T++++ Sbjct: 60 FRKEQGTIDSIFALKSLIDKHVKAKPKKTNNFL 92 >SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 326 WRDSQGTPDNIISMLTIF*KHIPAKFASTSHYI 424 +R QGT D+I ++ ++ KH+ AK T++++ Sbjct: 60 FRKEQGTIDSIFALKSLIDKHVKAKPQKTNNFL 92 >SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) Length = 300 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 326 WRDSQGTPDNIISMLTIF*KHIPAKFASTSHYI 424 +R QGT D+I ++ ++ KH+ AK T++++ Sbjct: 60 FRKEQGTIDSIFALKSLIDKHVKAKPKKTNNFL 92 >SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 326 WRDSQGTPDNIISMLTIF*KHIPAKFASTSHYI 424 +R QGT D++ ++ ++ KH+ AK T++++ Sbjct: 60 FRKEQGTIDSVFALKSLIDKHVKAKPKKTNNFL 92 >SB_3393| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=0.012) Length = 626 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 159 HPDYLWTHKTSTFTDISTNNGPAILLALEQPPNNLTDVLA 278 HPDY W + F ++ N A+L ++Q P+ +++A Sbjct: 28 HPDYRWVNANVNFDNV-INGFLALLQVIDQQPSYEANLIA 66 >SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23) Length = 417 Score = 27.9 bits (59), Expect = 7.4 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +3 Query: 312 TLACDGETVKAHQTILSACSPYFESIFL-QNSHPHPIIFLKDVRFAEMKSLLDFMYKGEV 488 T A + ++ AH+ +LS SP FE++F + I L D + +L + Y EV Sbjct: 35 TSAGEKISIPAHRYVLSVSSPVFEAMFHGAMAESSREISLPDCYAEALSEMLRYAYYDEV 94 Query: 489 NV-GQNML 509 + G N + Sbjct: 95 KLTGSNAM 102 >SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) Length = 418 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 326 WRDSQGTPDNIISMLTIF*KHIPAKFASTSHYI 424 +R QGT D++ ++ ++ KH+ AK T++++ Sbjct: 60 FRKEQGTIDSVFALKSLIDKHVKAKPKKTNNFL 92 >SB_38099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 613 RAHHWRRSLFRLRIQCIVLCQT 548 R HH RR LFR R +C+ + +T Sbjct: 345 RRHHERRRLFRYRQRCVKIWRT 366 >SB_21588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 169 IYGHTKQARSLTLAPTMDQQFCL-RWNNHPTI 261 +YGH+ + + ++PT QF R +NHP + Sbjct: 5 VYGHSVEDYDMAVSPTTAHQFMYSRGDNHPDL 36 >SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) Length = 259 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 421 IMGCGCEFCRNMLSKYGEHA 362 + CGC FC+ L +Y HA Sbjct: 39 LKSCGCFFCKECLKQYVAHA 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,998,588 Number of Sequences: 59808 Number of extensions: 428901 Number of successful extensions: 1149 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -