BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0505 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132902-3|CAC14419.1| 271|Caenorhabditis elegans Hypothetical ... 27 9.7 AL132902-2|CAB81987.1| 271|Caenorhabditis elegans Hypothetical ... 27 9.7 >AL132902-3|CAC14419.1| 271|Caenorhabditis elegans Hypothetical protein Y71A12B.3 protein. Length = 271 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 315 YAPSFFNALKYSLHDHMFNYLCLVIGDDAVLKNIVKIQKYTLIM 446 Y FF ++Y + + N L +D L+NIV +++ TL++ Sbjct: 23 YILRFFFNIRYDAFEELLNILT---SEDETLQNIVSVKEKTLVL 63 >AL132902-2|CAB81987.1| 271|Caenorhabditis elegans Hypothetical protein Y71A12B.2 protein. Length = 271 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 315 YAPSFFNALKYSLHDHMFNYLCLVIGDDAVLKNIVKIQKYTLIM 446 Y FF ++Y + + N L +D L+NIV +++ TL++ Sbjct: 23 YILRFFFNIRYDAFEELLNILT---SEDETLQNIVSVKEKTLVL 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,449,940 Number of Sequences: 27780 Number of extensions: 213287 Number of successful extensions: 409 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -