BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0505 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50780.1 68414.m05711 hypothetical protein weak similarity to... 31 0.55 At3g46470.1 68416.m05038 hypothetical protein 28 6.8 >At1g50780.1 68414.m05711 hypothetical protein weak similarity to aldehyde oxidase [Arabidopsis thaliana] GI:3172025 Length = 323 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -1 Query: 603 YSFKQTISFIISVLYTDIQNFLIIKYYQ 520 + KQTI ++IS+ Y+D+ NF+ + YQ Sbjct: 8 FIMKQTILYLISIPYSDVNNFVGVLRYQ 35 >At3g46470.1 68416.m05038 hypothetical protein Length = 199 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 285 LFDVSDDENRYAPSFFNALKYSLHDHMFNYLCLVIGDDA-VLKNIVKIQKYTLIMLCTVK 461 +F + +N P+ + + ++ F YL + +GD V K +++ +KY + C +K Sbjct: 103 IFCIKGFKNTLLPTVKRQVVNEIFENDFGYLYMYLGDQVDVEKTVLQKRKYLQVKECRMK 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,259,278 Number of Sequences: 28952 Number of extensions: 183162 Number of successful extensions: 295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -