BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0504 (722 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01185.1 68416.m00024 hypothetical protein 28 7.2 At1g77410.1 68414.m09015 beta-galactosidase, putative / lactase,... 28 7.2 >At3g01185.1 68416.m00024 hypothetical protein Length = 140 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -3 Query: 222 SIHCCAKSIPYNGTAVIVLRFIRYELYYIVFLKKVGMNLVLLNTDKCN 79 S +CC K I Y +VLR + ++ YY G +L ++C+ Sbjct: 87 SRYCCLKMIIYGQECHMVLRNLLFQTYYYKPFASKGRPRILKVWNRCS 134 >At1g77410.1 68414.m09015 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase SP:P45582 from [Asparagus officinalis] Length = 815 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 135 VFLKKVGM-NLVLLNTDKCNGTMNLNSNVYRL 43 VF KK + +L+N DKC T+ ++ YRL Sbjct: 363 VFGKKANLCAAILVNQDKCESTVQFRNSSYRL 394 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,089,139 Number of Sequences: 28952 Number of extensions: 240765 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -