BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0501 (720 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0995 - 29545058-29545204,29545988-29546074,29546166-295463... 59 3e-09 02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931,813... 28 6.5 12_02_0683 + 22006770-22006935,22007030-22007274,22007524-220077... 28 8.6 11_06_0542 + 24777453-24777632,24777654-24778478,24778576-247793... 28 8.6 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 28 8.6 >03_05_0995 - 29545058-29545204,29545988-29546074,29546166-29546361, 29546686-29546915 Length = 219 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/77 (38%), Positives = 44/77 (57%) Frame = +2 Query: 278 ELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGX 457 ELV+L++WK +RGK+ P+L +K V + KAF LP++ A+T L+ LKGVG Sbjct: 62 ELVRLLQWKLSRGKWRPRLMDFVKGLEDAVVESASCKAFAALPDLRKAITELTVLKGVGP 121 Query: 458 XXXXXXXXXXXPEIAPF 508 P++APF Sbjct: 122 ATASAVLAAYAPDVAPF 138 >02_02_0236 + 8135641-8135795,8136167-8136557,8136640-8136931, 8137117-8137271,8137363-8137451,8137623-8137967, 8139046-8139169,8139424-8139581,8139673-8139757, 8140094-8140306,8141314-8141375,8141466-8141951, 8142472-8142568 Length = 883 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 316 SSGLFPFHELDKFFVDHVR-ILPRDLIXLGSS 224 S LFP+ +L KFF VR I PR L G+S Sbjct: 330 SKVLFPYEDLVKFFQYEVRGISPRGLFNCGNS 361 >12_02_0683 + 22006770-22006935,22007030-22007274,22007524-22007727, 22007847-22007939,22008015-22008107,22008196-22008537, 22008675-22008737,22008812-22008892 Length = 428 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 382 EKGLPQTAQYRIRDDRSKQSQRRGNGHSISVISCR 486 E+G+ +T + R+R R Q N +IS++ CR Sbjct: 393 EEGVVRTNRKRVRCSRPDQDDSMSNQRNISMVFCR 427 >11_06_0542 + 24777453-24777632,24777654-24778478,24778576-24779319, 24779422-24780354,24780456-24780938,24780969-24781082, 24781240-24781636,24781732-24782024,24782392-24782802 Length = 1459 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 114 KEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNWYQNELPKXIKSRGKM 260 +E D+ I + A+++ +R E L+N+ +EL + +KS G M Sbjct: 190 QEHDAATSTSASIITVSADQRRRRALEPRSLENFCSDELTRWVKSVGTM 238 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 122 EFFCICLQKESRRVFRGSHCERSKC 48 E +C C K + FRG HC +S+C Sbjct: 474 EKYCGC-SKSCKNRFRGCHCAKSQC 497 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,529,108 Number of Sequences: 37544 Number of extensions: 438404 Number of successful extensions: 1024 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -