BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0498 (590 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 40 0.002 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25462| Best HMM Match : Peptidase_S8 (HMM E-Value=0) 38 0.005 SB_38551| Best HMM Match : Peptidase_S8 (HMM E-Value=0) 37 0.011 SB_3051| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_53678| Best HMM Match : Peptidase_S8 (HMM E-Value=0) 35 0.057 SB_3052| Best HMM Match : Peptidase_S8 (HMM E-Value=0) 34 0.076 SB_19021| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_22402| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 33 0.23 SB_37192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_14377| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 31 0.70 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_59605| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_59474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_58493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57892| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 30 1.6 SB_57404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_55455| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_54417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_53333| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_53165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51706| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50730| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_49151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_46331| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_45271| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_44211| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_44059| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_43927| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_42763| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40733| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_39959| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38014| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_36828| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_36605| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_34428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_32487| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30306| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29923| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29075| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26707| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26277| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26207| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22665| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 30 1.6 SB_19275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18225| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16810| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16271| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14277| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13227| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10525| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10161| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_8986| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_7195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_7091| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5986| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5977| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4980| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_3132| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1279| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_239| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_59758| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_59463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_58110| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_57106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56926| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56490| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_55777| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_54695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52532| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51098| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50392| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_48005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47502| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47004| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_46074| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) 30 1.6 SB_45721| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_44520| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_43209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41993| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41298| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40123| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40078| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38897| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_38010| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37529| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_36230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35279| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_33844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_33623| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_33302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_33202| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_32364| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31310| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31170| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30866| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30552| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30092| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29365| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29206| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28809| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27548| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26741| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24867| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23410| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22887| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22554| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20989| Best HMM Match : CRA_rpt (HMM E-Value=7.1) 30 1.6 SB_20821| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_19880| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_19056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18874| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17824| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16467| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_16042| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_15251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 30 1.6 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_12052| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_11508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10264| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 30 1.6 SB_7661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_7233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5712| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5044| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4299| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4200| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_3849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_3660| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1101| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_45855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_38254| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_31146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_7813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_1565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_59591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) 29 3.8 SB_59084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_51401| Best HMM Match : PseudoU_synth_1 (HMM E-Value=2e-28) 29 3.8 SB_24557| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_19812| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_7983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_42919| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 28 6.6 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_27827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) 28 6.6 SB_57272| Best HMM Match : V-ATPase_G (HMM E-Value=3) 28 6.6 SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) 28 6.6 SB_58617| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_28915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 360 YTPTWAVHIPEGREVADAVARDHGFVNLGKI--FDDHYHFHHRSLTKRS 500 YT WA+H+ G E A VA+ HGF + I + +YH H S RS Sbjct: 41 YTNGWAIHVNGGIEEAKEVAKAHGFEKVEPIGTLEGYYHLEHPSHPSRS 89 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 39.5 bits (88), Expect = 0.002 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +3 Query: 360 YTPTWAVHIPEGREVADAVARDHGFVNLGKI 452 ++ TWAV I G+ AD +A+ HG++NLG + Sbjct: 78 FSNTWAVQIEGGKTQADRIAKSHGYINLGPV 108 >SB_44965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1114 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +3 Query: 360 YTPTWAVHIPEGR-EVADAVARDHGFVNLGKI--FDDHYHFHHRSLTKR 497 ++ WAV + +ADA+AR HGF NLG I HY F H S R Sbjct: 434 FSNVWAVQLDSNDGSLADAIARAHGFKNLGGIGTLTGHYEFVHDSTGSR 482 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 470 FSSSFTNEEIPHAAHEHHGRLEGDSRVRWAEQQKILSRKK 589 F T + + RL RV WA+QQ+IL R+K Sbjct: 474 FVHDSTGSRMRRSMESRTKRLISHPRVIWAKQQRILDRQK 513 >SB_25462| Best HMM Match : Peptidase_S8 (HMM E-Value=0) Length = 446 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +3 Query: 360 YTPTWAVHIPEGR-EVADAVARDHGFVNLGKI--FDDHYHFHHRSLTKR 497 ++ WAV + +ADA+AR HGF NLG I HY F H S R Sbjct: 53 FSNVWAVQLDSNDGSLADAIARAHGFKNLGGIGTLTGHYEFVHDSTGSR 101 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 470 FSSSFTNEEIPHAAHEHHGRLEGDSRVRWAEQQKILSRKK 589 F T + + RL RV WA+QQ+IL R+K Sbjct: 93 FVHDSTGSRMRRSMESRTKRLISHPRVIWAKQQRILDRQK 132 >SB_38551| Best HMM Match : Peptidase_S8 (HMM E-Value=0) Length = 1357 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = +3 Query: 354 GHYTPTWAVHI--PEGREVADAVARDHGFVNLGKI--FDDHYHFHH 479 G++T TWAV I P + +++ HGF +GKI HYH H Sbjct: 907 GYFTNTWAVEIEHPFEEKYVREISKRHGFTIIGKIGNLKGHYHLRH 952 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +2 Query: 527 RLEGDSRVRWAEQQKILSR 583 RL + VRWAEQQKIL R Sbjct: 969 RLLLEDNVRWAEQQKILHR 987 >SB_3051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 360 YTPTWAVHIPEGR-EVADAVARDHGFVNLGKI--FDDHYHFHHRSLTKR 497 + +WAVH+ + + +A HGFVNLG+I +YHF RS R Sbjct: 34 FANSWAVHLDNADPDSVEKIATRHGFVNLGQIGSLPGYYHFVKRSTEMR 82 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 515 EHHGRLEGDSRVRWAEQQKILSRKK 589 EH RL+ + +V W EQQ+IL R K Sbjct: 89 EHADRLQDEPQVTWVEQQRILERSK 113 >SB_53678| Best HMM Match : Peptidase_S8 (HMM E-Value=0) Length = 782 Score = 34.7 bits (76), Expect = 0.057 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 360 YTPTWAVHIP-EGREVADAVARDHGFVNLGKIFDDHYHFH 476 +T +WAV + + E+A VAR HGF G+I + HFH Sbjct: 142 FTNSWAVELDSDDEELAKEVARKHGFKYAGRIGELPGHFH 181 >SB_3052| Best HMM Match : Peptidase_S8 (HMM E-Value=0) Length = 1124 Score = 34.3 bits (75), Expect = 0.076 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 360 YTPTWAVHIPEGR-EVADAVARDHGFVNLGKIFD 458 +T +WAV + E AD +A HGF NLG+ D Sbjct: 360 FTNSWAVQLDSAEVEAADRIAAKHGFTNLGQFND 393 >SB_19021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 590 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 360 YTPTWAVHIPEGREVADAVARDHGFVNL--GKIFDDHYHFHHRSLTKR 497 YT TW ++ +G+E D +A HGF + G + Y H+ +KR Sbjct: 28 YTNTWVIYTDKGQEYVDNLAAKHGFKSHRDGGGLEGFYILEHQRTSKR 75 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEI---PHAAHEHHGRLEGDSR 547 RPY ++R C R PR RQ + RS P S++ + I HA L+G Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGILAERHAPQAPRSALDGVYH 64 Query: 548 VRWAEQQKILSRKK 589 WA +R+K Sbjct: 65 PFWAAFPNNPTRRK 78 >SB_22402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEHHGRLEGDSR 547 RPY ++R C R PR RQ + RS P S+ T+ E A+ H +L G R Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLANGMHRKLLGQVR 59 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 7/59 (11%) Frame = +2 Query: 434 RQSWKDIRRSLPFSSSFTNEEIPHAAHEHHGRLEGDSR-------VRWAEQQKILSRKK 589 ++S +IR+S PF+ TN+++ H A++H E D R +R EQ K L KK Sbjct: 80 QKSETEIRKSAPFA---TNKDVRHQAYQHIRDYEADKRRLADSIEIRRQEQAKTLEEKK 135 >SB_37192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.5 bits (68), Expect = 0.53 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEHHGRLEG 538 RPY ++R C R PR RQ + RS P S+ T+ E A H +L G Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREERTLAERHAPQLLG 56 >SB_14377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.5 bits (68), Expect = 0.53 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEHHGRLEG 538 RPY ++R C R PR RQ + RS P S+ T+ E A H +L G Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGILAERMHRKLLG 56 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 31.1 bits (67), Expect = 0.70 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEI---PHAAHEHHGRLEGDSR 547 RPY ++R C R PR RQ + RS P S++ + HA L+G Sbjct: 291 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSALDGVYH 350 Query: 548 VRWAEQQKILSRKK 589 WA +R+K Sbjct: 351 PFWAAFPNNPTRRK 364 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 30.7 bits (66), Expect = 0.93 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEI---PHAAHEHHGRLEGDSR 547 RPY ++R C R PR RQ + RS P S++ + HA L+G Sbjct: 5 RPYDRQRRGCIVRNPRPRDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSALDGFYH 64 Query: 548 VRWAEQQKILSRKK 589 WA +R+K Sbjct: 65 PFWAAFPNNPTRRK 78 >SB_59605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_59474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 42 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 87 >SB_58493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 42 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 87 >SB_57892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 6 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 51 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 115 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 160 >SB_57404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_56779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_55455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_54417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_53333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_53165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_50730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_50129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_49151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_46331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_45271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_44211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_44059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_43927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_42763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_41768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_39959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_38014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 152 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 197 >SB_36828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_36605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 42 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 87 >SB_35096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_34428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 42 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 87 >SB_32487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_31894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_30306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_29923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_29075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_29022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_28754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_27796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_27412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_26752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 14 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 59 >SB_26707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_26277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_26207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_24849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 15 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 60 >SB_24213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_24112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_22665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_22357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_22210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_21949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSS 481 RPY ++R C R + PR RQ + RS P S++ Sbjct: 5 RPYDHQRRGCIVRNRRPRDRQQSRRTARSPPHSTT 39 >SB_19275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_18225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_17293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_16832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_16810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_16271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 2 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 47 >SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_14674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_14277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_13227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_10525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_10161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_8986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 42 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 87 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_7195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_7091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_5986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_5977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_4980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_4119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_3132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_1428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_1279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_59758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_59463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_58110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_57106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_56926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_56490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_56320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_55777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S++ P H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDRGRRDPSRKGMH 52 >SB_54695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_52532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_50392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 2 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 47 >SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAH 514 RPY ++R C R PR RQ + RS P S++ + I H Sbjct: 172 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGILAERH 217 >SB_48005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_47502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_47004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_46074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) Length = 187 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 36 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 81 >SB_45721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_44520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_43209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_41993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_41298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_40078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_38897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_38256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_38010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_37529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_37407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_36230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_35919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_35494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_35340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_35279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 372 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 417 >SB_33844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_33623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_33302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_33202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_32364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_31435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_31310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_31170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_30866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 14 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 59 >SB_30552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_30428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_30302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAH 514 RPY ++R C R PR RQ + RS P S++ + I H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGILAERH 50 >SB_30092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_29365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_29206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 43 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 88 >SB_28809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_28597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_28506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_28222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_28112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_27548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 42 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 87 >SB_26741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_24867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 2 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 47 >SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_23669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_23410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_22887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_22554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_21985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_20989| Best HMM Match : CRA_rpt (HMM E-Value=7.1) Length = 138 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_20821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_20275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_19880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_19056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_18874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_17824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_17650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_16467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_16042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_15251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_14542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 104 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 149 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 2 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 47 >SB_12052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_11508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_10264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) Length = 122 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 69 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 114 >SB_7661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_7233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_5712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_5044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_5043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_4299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_4200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_3849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAH 514 RPY ++R C R PR RQ + RS P S++ + I H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGILAERH 50 >SB_3660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 6 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 51 >SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 48 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 93 >SB_1460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_1101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_56766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDRQRRGCIVRNPRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_45855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSS 481 RPY ++R C R PR RQ + RS P S++ Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTT 39 >SB_38254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSS 481 RPY ++R C R PR RQ + RS P S++ Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTT 39 >SB_31146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSS 481 RPY ++R C R PR RQ + RS P S++ Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTT 39 >SB_7813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSS 481 RPY ++R C R PR RQ + RS P S++ Sbjct: 5 RPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHSTT 39 >SB_1565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 RPYDHQRRVCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_59591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 +PY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 KPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) Length = 832 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = +2 Query: 392 RKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEHHGRLEGDSRVRWAEQQK 571 RKR R RRQ R R + +R L E++ HE H R R +W +Q+ Sbjct: 213 RKRRQRLRRQERRKRHLERQRQRYL--------EKLRRLKHEKHLRRLKRLREQWGRRQR 264 Query: 572 ILSRKK 589 L+R+K Sbjct: 265 QLAREK 270 >SB_59084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 +PY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 KPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_51401| Best HMM Match : PseudoU_synth_1 (HMM E-Value=2e-28) Length = 503 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -1 Query: 473 KMVVIVEYLSKIDEAVVPGDGIGNFSSFRYM 381 K + E L+ +D A +PG+ + N+SSF+ M Sbjct: 384 KATLAQELLASLDSAEIPGNPLTNWSSFKPM 414 >SB_24557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAH 514 +PY ++R C R PR RQ + RS P S++ + I H Sbjct: 5 KPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGILAERH 50 >SB_19812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 +PY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 5 KPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_7983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 836 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 333 TEPTPGSRVREHRAPSHGHTHQLVLITLHI 244 T P+P S R H H H +IT+HI Sbjct: 83 TAPSPPSTSSSQRHHHHPHHHHSAIITIHI 112 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 333 TEPTPGSRVREHRAPSHGHTHQLVLITLHI 244 T P+P S R H H H +IT+HI Sbjct: 245 TAPSPPSTSSSQRHHHHPHHHHSAIITIHI 274 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 333 TEPTPGSRVREHRAPSHGHTHQLVLITLHI 244 T P+P S R H H H +IT+HI Sbjct: 441 TAPSPPSTSSSQRHHHHPHHHHSAIITIHI 470 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -3 Query: 384 YGRPMLACNALVLFQCATEPTPGSRVREHRAPSHGHTHQLVLITLHI 244 Y + + ++L + P+ S R H P H H+ +IT+HI Sbjct: 723 YHSAITTIHIIILITAPSSPSTSSSERHHHHPHHQHS---AIITIHI 766 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -3 Query: 333 TEPTPGS---RVREHRAPSHGHTHQLVLITLHI 244 T P+P S R H P H H+H+ +IT+HI Sbjct: 537 TAPSPPSISLSQRHHHHPHH-HSHKSAIITIHI 568 >SB_42919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 380 PYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 PY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 6 PYDRQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P + T+ E A H Sbjct: 153 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHPT--TDREDGTLAERH 198 >SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P + T+ E A H Sbjct: 76 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHPT--TDREDGTLAERH 121 >SB_27827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 380 PYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 PY ++R C R PR RQ + RS P S+ T+ E A H Sbjct: 6 PYDHQRRGCIVRNHRPRDRQQSRRTARSPPHST--TDREDGTLAERH 50 >SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) Length = 1559 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/91 (21%), Positives = 34/91 (37%), Gaps = 1/91 (1%) Frame = -3 Query: 549 TLLSPSNLP*CSWAA*GISSLVNDDENGSDRRISFQD*RSRGPWRRHRQ-LLFLPVYGRP 373 TL + N+ S + ++ND E + I R W R RQ + +P + Sbjct: 438 TLTTDGNIVSTSTIYENLKQILNDPEQSPEFPIGLLTTDERETWARLRQAITAIPAHQEA 497 Query: 372 MLACNALVLFQCATEPTPGSRVREHRAPSHG 280 M ++ + C + P + R HG Sbjct: 498 MRLIDSAIFTICLDDEVPSDPMHLARIMLHG 528 >SB_57272| Best HMM Match : V-ATPase_G (HMM E-Value=3) Length = 148 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +2 Query: 377 RPYTGRKRSCRC----RRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEHHGRLEGDS 544 +P++ RKR ++ LRQ R+S S + +P GR+ D Sbjct: 9 QPFSMRKRQLNILLEKMKEERSLRQQLNKARKSKMLKSRNPEDAMPEEIIVEQGRIREDH 68 Query: 545 RVRWAEQQKILSR 583 + AE++K+++R Sbjct: 69 QKSEAEKRKVMAR 81 >SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 156 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +2 Query: 377 RPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPFSSSFTNEEIPHAAHEH 520 RPY ++R C R PR RQ + RS P + T+ E A H Sbjct: 5 RPYDRQRRGCIVRNHRPRDRQQSRRTARSPPHPT--TDREDGTLAERH 50 >SB_58617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 371 MGRPYTGRKRSCRCRRQGPRLRQSWKDIRRSLPF 472 + RPYT K+ C+C+RQ WK R P+ Sbjct: 10 LSRPYTYFKKRCQCKRQ--MAIDKWKFYDRKDPW 41 >SB_28915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/55 (21%), Positives = 27/55 (49%) Frame = -1 Query: 194 LKKKNTPTVTXXXXXXSCQSLICMRYQREPQRGTVMFCSKHSPRGTQYDCQMARE 30 + + +TP + +CM+Y + +R V+ KH+ + ++DC++ E Sbjct: 67 ITEMDTPYTIRAQELRDIYNTLCMKYLTQDERLDVLLTLKHTVK--EHDCKLTHE 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,458,993 Number of Sequences: 59808 Number of extensions: 401167 Number of successful extensions: 1241 Number of sequences better than 10.0: 236 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -