BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0498 (590 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 1.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 3.9 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 9.0 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 578 TGFFVVQPIVPCYHLLI 528 TG+F++Q VPC +++ Sbjct: 244 TGYFLIQVYVPCVLIVV 260 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 321 PGSRVREHRAPSHGHTHQLVLITLHIHKTV*VD 223 PG+ VR P H H + + I+ + H V +D Sbjct: 531 PGAVVRVFLGPKHDHQGRPISISKNQHLFVELD 563 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.0 bits (42), Expect = 9.0 Identities = 5/13 (38%), Positives = 8/13 (61%) Frame = +3 Query: 450 IFDDHYHFHHRSL 488 I+ H+H HH + Sbjct: 69 IYQSHHHLHHHQV 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,197 Number of Sequences: 438 Number of extensions: 3584 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -