BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0497 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59567| Best HMM Match : Cyclin_N (HMM E-Value=3.3e-07) 39 0.004 SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) 38 0.007 SB_28497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_13359| Best HMM Match : DMAP1 (HMM E-Value=0) 33 0.27 SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_36680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_47526| Best HMM Match : Churchill (HMM E-Value=0.52) 29 3.4 SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) 29 3.4 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 29 4.5 SB_39987| Best HMM Match : FtsL (HMM E-Value=0.4) 29 4.5 SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 28 5.9 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 28 5.9 SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 28 7.8 SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) 28 7.8 SB_10637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_385| Best HMM Match : SRP54_N (HMM E-Value=1.1) 28 7.8 SB_159| Best HMM Match : TP2 (HMM E-Value=0.58) 28 7.8 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_59567| Best HMM Match : Cyclin_N (HMM E-Value=3.3e-07) Length = 282 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/71 (30%), Positives = 41/71 (57%) Frame = +2 Query: 92 NQVIKAERRILKELGFCVHVKHPHKLIVVYLQLLQYEKNRQLMQMAWNYMNDALRQMSL* 271 NQV++ E +L+ L C+ + HP++ + Y+ L E+ ++ AW +ND+LR Sbjct: 134 NQVLECEFYLLEMLDCCLIIYHPYRPLTQYVSDLGMEE--AILPTAWRIINDSLRTDI-- 189 Query: 272 DFLLKPLHVLA 304 FL+ P +++A Sbjct: 190 -FLIYPPYLIA 199 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/70 (31%), Positives = 37/70 (52%) Frame = +1 Query: 253 KTDVFMRFPPETIACACIYLTARKIGLPLPNNPHWFLLFKVTEDDIREVSMRILQLYKRA 432 +TD+F+ +PP IA A I++ + ++ WF V D I E++ IL+LY+ Sbjct: 186 RTDIFLIYPPYLIALAAIHMAC---VIQQKDSKQWFAELSVDMDQIVEITHHILRLYEIW 242 Query: 433 KVNPEELETK 462 K E+ E + Sbjct: 243 KNFEEKQEIR 252 >SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) Length = 228 Score = 37.9 bits (84), Expect = 0.007 Identities = 23/85 (27%), Positives = 37/85 (43%) Frame = +1 Query: 367 FKVTEDDIREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHSQE*KIKKLRTKKRN 546 FK+++D +E M + + + ++LE + K+ K K KK + Sbjct: 82 FKLSQDTKKEGEMAEKKAKAKERKLQKQLEKEAAEEEKVKKPKKSRDGEKTKKSKKVTSE 141 Query: 547 PKSPTASTSKDTRRDTKKEKSPKTP 621 PKSP SKD T K+ K+P Sbjct: 142 PKSPKVKKSKDKSTKTTKKSDAKSP 166 >SB_28497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Frame = +1 Query: 406 RILQLYKRAKVNPEELETKVENLRKIYIANKHSQE*K--IKKLRTKKRNPKSPTASTSKD 579 ++L+LY R + +E E + LRKI + K ++ + ++KL T N + +K+ Sbjct: 180 QLLKLYNRTQEQVQEEEMLMAELRKIEMRKKEREKKQQDLQKLITAAENSAEYRQNLAKE 239 Query: 580 TRRDTKKEKSP 612 + ++EK+P Sbjct: 240 KTNNFRREKNP 250 >SB_15826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = +1 Query: 451 LETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSPTASTSKDTRRDTK 597 L+TK+ ++ + + K SQ + KK + KK+ P TS TR+D+K Sbjct: 28 LQTKMADVTRSLPSEKSSQN-QAKKRKKKKQKTHRPVTETSPSTRKDSK 75 >SB_13359| Best HMM Match : DMAP1 (HMM E-Value=0) Length = 535 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Frame = +1 Query: 406 RILQLYKRAKVNPEELETKVENLRKIYIANKHSQE*K--IKKLRTKKRNPKSPTASTSKD 579 ++L+LY R + +E E + LRKI + K ++ + ++KL T N + +K+ Sbjct: 303 QLLKLYNRTQEQVQEEEMLMAELRKIEMRKKEREKKQQDLQKLITAAENSAEYRQNLAKE 362 Query: 580 TRRDTKKEKSP 612 + ++EK P Sbjct: 363 KTNNFRREKKP 373 >SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = +1 Query: 451 LETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSPTASTSKDTRRDTKKEKSPKT 618 L+ VEN+ + AN+ E + K R +K P +P +K +RD KK+KS T Sbjct: 45 LKDLVENIPDLP-ANEEEGEGEPKPKR-RKAQPSAPKEKQTKSRKRDKKKDKSALT 98 >SB_36680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = +1 Query: 412 LQLYKRAKVNPEELETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSPTASTSKDTRRD 591 + ++ K ++ ETK + + I + KK + K + PK+ + KD + Sbjct: 126 VSVFDCVKEETQDEETKQDQACIMAIEEMFPPVRQKKKAKRKNQRPKASQCRSRKDIKEC 185 Query: 592 TKKEKSPK 615 TKKE P+ Sbjct: 186 TKKEDEPE 193 >SB_47526| Best HMM Match : Churchill (HMM E-Value=0.52) Length = 890 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 388 IREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHS 504 + V ++ LY RAK +P LET + + +YI K+S Sbjct: 183 LETVQQKMTLLYLRAKNSPHILETDQQEMTLLYIRAKNS 221 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 343 NNPHWFLLFKVTEDDIREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHS 504 N+PH + E D +E+++ LY RAK +P +LET + + +YI K+S Sbjct: 199 NSPH------ILETDQQEMTL----LYIRAKNSPHKLETVQQEMTLLYIRAKNS 242 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 343 NNPHWFLLFKVTEDDIREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHS 504 N+PH + E D +E+++ LY RAK +P +LET + + +YI K+S Sbjct: 409 NSPH------ILETDQQEMTL----LYIRAKNSPHKLETVQQEMTLLYIRAKNS 452 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 343 NNPHWFLLFKVTEDDIREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHS 504 N+PH + E D +E+++ LY RAK +P +LET + + +YI K+S Sbjct: 829 NSPH------ILETDQQEMTL----LYIRAKNSPHKLETVQQEMTLLYIRAKNS 872 >SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) Length = 491 Score = 29.1 bits (62), Expect = 3.4 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 1/102 (0%) Frame = +1 Query: 313 TARKIGLPLPNNPHWFLLFKVTEDDIREVSMRILQLYKRAKVNPEELETKVENL-RKIYI 489 T R L +P L FK D ++ L+ + + P+E KV +L +++Y Sbjct: 375 TRRFNPLVIPKKLQKDLPFKSKPKDAKKRQRPSLESKRAVVMEPQE--KKVYSLMQQLYT 432 Query: 490 ANKHSQE*KIKKLRTKKRNPKSPTASTSKDTRRDTKKEKSPK 615 ANK + +KL K++ ++ A D++R TK+ + K Sbjct: 433 ANKEKLRKRKEKLVQKRKVHRAEQAKI--DSKRQTKRREERK 472 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +1 Query: 394 EVSMRILQLYKRAK-VNPEELETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSPTAST 570 +V R+ + + +K + PEE + +++ KI IA + + ++KKL K N + PT+ T Sbjct: 205 DVRSRLESVQEESKELTPEEQQERIK-AEKIRIALEKLRAARVKKLVVKVYNDEDPTSKT 263 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/67 (31%), Positives = 32/67 (47%) Frame = +1 Query: 379 EDDIREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSP 558 E ++ + R + +RA+ PEE +T LRK E K K+ RT +R KSP Sbjct: 1477 ETEVPDNGGRETRSKRRAQNAPEEDKTVKRTLRKRTSEPTKQYEPKTKQTRTSRR-AKSP 1535 Query: 559 TASTSKD 579 + K+ Sbjct: 1536 AGAEKKN 1542 >SB_39987| Best HMM Match : FtsL (HMM E-Value=0.4) Length = 573 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/86 (23%), Positives = 39/86 (45%) Frame = +1 Query: 355 WFLLFKVTEDDIREVSMRILQLYKRAKVNPEELETKVENLRKIYIANKHSQE*KIKKLRT 534 W + K + + V R+L + KV+P + E +++ K A S Sbjct: 297 WRNVVKRVFESTKAVPSRVLMRLRHQKVDPSQEELVAKSVTKPGTARMPS--------TA 348 Query: 535 KKRNPKSPTASTSKDTRRDTKKEKSP 612 ++RN ++ + +T+ + DT KE +P Sbjct: 349 RQRNQQTQSRATAGGIKMDTPKENTP 374 >SB_23319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +1 Query: 445 EELETKVENLRKIYIANKHSQE*KIKKL-----RTKKRNPKSPTASTSKDTRRDTKKEKS 609 E + + +++R+I K QE + K++ KK+ K +A + + +TKK K Sbjct: 72 ESMNYEEDDVRRILEDLKVEQEEQKKRMARELEEAKKKVAKEKSAKPKESKKPETKKPKK 131 Query: 610 PKTPP 624 P T P Sbjct: 132 PDTAP 136 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 529 RTKKRNPKSPTASTSKDTRRDTKKEKSPK 615 +TK+ P+ A+ K RR TKK K+ K Sbjct: 211 KTKRSKPQDKQAARPKQPRRKTKKSKTSK 239 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +1 Query: 424 KRAKVNPEELETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKS-PTASTSKDTRRDTKK 600 K K E+ K E K K +E + +K +TKK +S T K+ + +K Sbjct: 134 KEEKKEKEKERMKKEEKHKEK-TRKEEKEREKEKEKTKKEEKESREKEKTKKEEKESKEK 192 Query: 601 EKSPKTPP 624 +K K PP Sbjct: 193 DKQKKDPP 200 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 28.3 bits (60), Expect = 5.9 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 3/89 (3%) Frame = +1 Query: 361 LLFKVTEDDIREVSMRILQLYKRAKVNPEE--LETKVENLRKIY-IANKHSQE*KIKKLR 531 L++K E+ + E + LY V ++ E EN+ I I H +E K + Sbjct: 161 LVYKAVEELVNEELRKQNHLYVNVSVGDQQGGEEQNYENVAFIRSIQRLHLEEKKASRPP 220 Query: 532 TKKRNPKSPTASTSKDTRRDTKKEKSPKT 618 + P P +TSK E PKT Sbjct: 221 ENRPIPTPPRETTSKTQEPKNVMELPPKT 249 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/56 (32%), Positives = 30/56 (53%) Frame = +1 Query: 451 LETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSPTASTSKDTRRDTKKEKSPKT 618 LE+KV++ K S+ K K + K R+ +S + ++DT +D K +SP T Sbjct: 153 LESKVQSNEKDTDEKLSSKLLKCLKDKHKSRS-RSNSKDKAQDTEKDRKSSRSPST 207 >SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 520 KKLRTKKRNPKSPTASTSKDTRRDTKKEKSPKT 618 +K T+ +N PT S S D+RR TK S T Sbjct: 138 QKQSTESKNIPGPTNSISSDSRRITKTTNSNST 170 >SB_10637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 384 IFCNFE*KEPV--WVIGQRQTYFSGRQVNASTCNGFRR 277 IF FE E V W G R+T+F V+A+ FRR Sbjct: 19 IFQRFETFESVLVWTAGSRRTHFENDNVDANQVMRFRR 56 >SB_385| Best HMM Match : SRP54_N (HMM E-Value=1.1) Length = 210 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +1 Query: 442 PEELETKVENLRKIYIANKHSQE*KIKKLRTKKRNPKSPTASTSKDTRRDTKKEKSPKTP 621 P + + K E+ K +K S+ K TKK + KSP S T + T +K+PK Sbjct: 65 PPKKKKKAESKPKSAEKSKSSKSKTPAKKETKKESKKSPKKS-KPVTVKITSGKKTPKKS 123 Query: 622 P 624 P Sbjct: 124 P 124 >SB_159| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 520 KKLRTKKRNPKSPTASTSKDTRRDTKKEKSPKT 618 +K T+ +N PT S S D+RR TK S T Sbjct: 138 QKQSTESKNIPGPTNSISSDSRRITKTTNSNST 170 >SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 27.9 bits (59), Expect = 7.8 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 4/85 (4%) Frame = +1 Query: 373 VTEDDIREVSMR--ILQLYKRAKVNPEELETKVENLR--KIYIANKHSQE*KIKKLRTKK 540 V E DI + R ILQL + ++ L ++V N K ++ K+KK R KK Sbjct: 346 VIETDIMKNYFRQHILQLLREYRIRKGTLPSRVTNTDNYKSRLSINEIVSKKLKKKRKKK 405 Query: 541 RNPKSPTASTSKDTRRDTKKEKSPK 615 +N K + + R+ +K K Sbjct: 406 KNRKLRKRNRKRKQRKLARKRLKEK 430 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,105,549 Number of Sequences: 59808 Number of extensions: 372701 Number of successful extensions: 1301 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1293 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -