BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0496 (670 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6B8E3 Cluster: Putative uncharacterized protein; n=1; ... 33 4.7 UniRef50_UPI00015556CD Cluster: PREDICTED: hypothetical protein;... 33 8.2 >UniRef50_A6B8E3 Cluster: Putative uncharacterized protein; n=1; Vibrio parahaemolyticus AQ3810|Rep: Putative uncharacterized protein - Vibrio parahaemolyticus AQ3810 Length = 119 Score = 33.5 bits (73), Expect = 4.7 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = -2 Query: 315 LLWVRQSAGFKHRCIASDE*TDALSLGHDDFKTDFYNHSVRRGYTTQLDSKNQ 157 L W R + G+ +C A + D L+L DD TD Y R Q D KNQ Sbjct: 39 LYWARGARGWSMKCTAERDGND-LTLTRDD-ATDLYKEQFERFQLRQADWKNQ 89 >UniRef50_UPI00015556CD Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 622 Score = 32.7 bits (71), Expect = 8.2 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 342 VLQTACCVIVVVLCIGRGDG-KWKEKDRETLRHDIELYKRMADKIEREIE 488 +L CCV + C GR G K K K + L+ EL K DK++ E+E Sbjct: 184 LLLLCCCVCICKKCCGRKKGKKAKGKAQIHLKEVKELGKSYIDKVQPEVE 233 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,176,262 Number of Sequences: 1657284 Number of extensions: 10712241 Number of successful extensions: 27358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27349 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -