BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0496 (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23620.1 68417.m03402 50S ribosomal protein-related contains ... 29 3.7 At1g56040.1 68414.m06434 U-box domain-containing protein contain... 28 4.9 >At4g23620.1 68417.m03402 50S ribosomal protein-related contains weak similarity to 50S ribosomal protein L25 (TL5). (Swiss-Prot:P56930) [Thermus thermophilus] Length = 264 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 20 SENSNNIRKFVNEFGYSLKLNRL 88 S +N IRK VN GYS L+RL Sbjct: 96 SVQTNQIRKLVNHLGYSFFLSRL 118 >At1g56040.1 68414.m06434 U-box domain-containing protein contains Pfam profile PF04564: U-box domain Length = 437 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = +3 Query: 408 KEKDRETLRHDIELYKRMADKIEREIETFYDEYPRRS 518 ++K+ E ++ +E Y+R + + E+ T+ D+Y + S Sbjct: 263 EKKELEEVKLKLETYEREQENLSSEVRTWQDKYEQES 299 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,710,025 Number of Sequences: 28952 Number of extensions: 245878 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -