BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0494 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 5.1 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 5.1 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 6.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 436 RGAIILAKLSVLPVRRGYWGNKIGSHTP 519 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 436 RGAIILAKLSVLPVRRGYWGNKIGSHTP 519 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 436 RGAIILAKLSVLPVRRGYWGNKIGSHTP 519 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 436 RGAIILAKLSVLPVRRGYWGNKIGSHTP 519 R + + +++ V G+W N I H+P Sbjct: 250 RADLWIIPIAIFLVSLGWWENYISRHSP 277 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 290 MMRFLRSCLYRNKHVPDSAHVSRHL 364 + ++ L + K PD A + RHL Sbjct: 43 LKNYVNCLLEKGKCTPDGAELKRHL 67 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 453 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 361 K NS +NGS D + ++ + NG+K Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 564 LIPAPRCTGIVSAPVP 611 L+P P C+ S+P P Sbjct: 190 LLPTPTCSEASSSPTP 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,915 Number of Sequences: 336 Number of extensions: 3274 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -