BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0492 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 70 7e-14 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 6.1 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 23 8.1 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 70.1 bits (164), Expect = 7e-14 Identities = 30/54 (55%), Positives = 43/54 (79%) Frame = +1 Query: 247 Y*VNERDDGNTIQDNLAQLTGFRTVPQVFINGNCVGGGSDVKALYESGKLEPML 408 Y +++R+DG+ IQ L +LTG RTVP+VFI GN VGGG+D+K +Y+ G+L+ ML Sbjct: 2 YELDKRNDGDEIQSVLGELTGARTVPRVFIGGNFVGGGTDIKKMYDDGRLQKML 55 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 118 YRHSTVYQGSYLQRQSCSVLQILLS 192 +RH Y +Y Q +SC + Q+ +S Sbjct: 320 HRHPFQYHPTYDQHKSCRIQQLYVS 344 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 23.4 bits (48), Expect = 8.1 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = +3 Query: 294 RTTDWFQNCTSSLYKWQLCGRWL*C*SIV*IWKIRTYVNRINFKLIVLLLFAYLNLYFGV 473 + T++ +LY W+LC RW+ + + ++ I Y N + + ++ + Y + +G+ Sbjct: 522 KDTEFMLGHRPNLY-WRLCWRWI---TPLLMFVILIY-NLVTLEPLMYRQYVYPTVAYGI 576 Query: 474 HIKCYLRFKLIQ 509 C F L+Q Sbjct: 577 G-WCIFAFGLLQ 587 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,767 Number of Sequences: 2352 Number of extensions: 15179 Number of successful extensions: 42 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -