BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0490 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0584 - 24082867-24082960,24083071-24083191,24083693-240837... 57 1e-08 >02_04_0584 - 24082867-24082960,24083071-24083191,24083693-24083786, 24084675-24084725 Length = 119 Score = 57.2 bits (132), Expect = 1e-08 Identities = 22/48 (45%), Positives = 35/48 (72%) Frame = +3 Query: 255 YDISQLFDFVDQLADLSCLVYQKSTNTYAPYNKDWIKEKIYVLLRQAA 398 YDI+ L++F+D LAD+S LVY S + PY++ WIK+K++ L++ A Sbjct: 70 YDITDLYNFIDGLADISALVYDHSIQAFLPYDRQWIKQKLFQHLKKLA 117 Score = 55.2 bits (127), Expect = 5e-08 Identities = 21/49 (42%), Positives = 32/49 (65%) Frame = +1 Query: 109 HTILLVQPGPRPETRTYSDYESVNDCMEGVCKIYEEHLKRRNPNTPTIT 255 HTI+L+QP +RT+ DY S+N ++G+C +YE ++ NP P IT Sbjct: 21 HTIILMQPSQNRASRTFMDYNSINHALDGLCGLYERKIRDINPMVPNIT 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,908,355 Number of Sequences: 37544 Number of extensions: 345404 Number of successful extensions: 666 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -