BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0483 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 27 0.56 Z22930-2|CAA80514.1| 274|Anopheles gambiae trypsin-related prot... 25 1.7 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 25 1.7 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 24 4.0 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 24 4.0 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 5.3 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 5.3 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 5.3 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 5.3 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 5.3 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 5.3 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 5.3 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 5.3 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 5.3 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 5.3 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 5.3 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 5.3 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 5.3 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 5.3 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 5.3 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 5.3 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 5.3 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 5.3 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 7.0 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 23 7.0 AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha su... 23 7.0 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 23 7.0 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 23 7.0 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 23 7.0 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 23 7.0 AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-tran... 23 9.2 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 27.1 bits (57), Expect = 0.56 Identities = 12/59 (20%), Positives = 28/59 (47%) Frame = -3 Query: 575 LALAKSFSPPTWASIK*SQ*MVAVQLHGEGRKR*IVTLPFVQWRLAWPHGRDAGGDNLR 399 + + +++PP+W + + + + L G + +V F W +W + A G++ R Sbjct: 83 ILIVSAYAPPSWTVQEFEELLDNIVLTVSGSSKFVVAGDFNAWSSSWANTLGARGESQR 141 >Z22930-2|CAA80514.1| 274|Anopheles gambiae trypsin-related protease protein. Length = 274 Score = 25.4 bits (53), Expect = 1.7 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +2 Query: 194 PTKMFQRISIDRRRGPGGDVQFDK-VPLPYEKLTKNLEVVKKRLGRELTLSEKILYSHLD 370 P+K R+ G V+ + VP P N ++ L ELT SEK+ L Sbjct: 95 PSKPTVRVGSSEHASGGTVVRVARIVPHPMHGSKNNYDIALLELKNELTFSEKVQPIALP 154 Query: 371 DPKGQEIERG 400 + + + IE G Sbjct: 155 E-QDEPIEEG 163 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 595 ILLC*GP*PWPNPSRLRLGLRSSDHNEWWRYSYTGKAG 482 +L G P +P+R + LR EW+R Y G+ G Sbjct: 263 VLTATGVFPEGHPARTDVRLRVLQDAEWFRVPYPGQFG 300 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 628 WSRFLEARLWY 660 W R LEA++WY Sbjct: 312 WDRILEAKVWY 322 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 628 WSRFLEARLWY 660 W R LEA++WY Sbjct: 312 WDRILEAKVWY 322 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 175 LNEIDTVNFAELAASSDTLEHL 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 265 LVELDIATWAAAAVNGDTLKHL 200 L E+D +A A + DTL+HL Sbjct: 100 LNEIDTVNFAELAASSDTLEHL 121 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 267 LNKKDLLEEKIMYSHLVD 284 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 124 LNKKDLLEEKIMYSHLVD 141 >AY724807-1|AAW50316.1| 127|Anopheles gambiae G protein alpha subunit AgGq5 protein. Length = 127 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 81 LNKKDLLEEKIMYSHLVD 98 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 81 LNKKDLLEEKIMYSHLVD 98 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 80 LNKKDLLEEKIMYSHLVD 97 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 81 LNKKDLLEEKIMYSHLVD 98 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 320 LGRELTLSEKILYSHLDD 373 L ++ L EKI+YSHL D Sbjct: 80 LNKKDLLEEKIMYSHLVD 97 >AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-transferase E6 protein. Length = 227 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 341 SEKILYSHLDDPKGQEIERGASYLRLRPD 427 S+ +LY+H P G+ +E L L D Sbjct: 3 SKPVLYTHTISPAGRAVELTVKALNLDVD 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,887 Number of Sequences: 2352 Number of extensions: 15583 Number of successful extensions: 72 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -