BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0481 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 120 1e-27 SB_42121| Best HMM Match : EGF_CA (HMM E-Value=8.7) 43 2e-04 SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) 31 1.1 SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) 31 1.4 SB_12261| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) 30 2.4 SB_44412| Best HMM Match : DUF1070 (HMM E-Value=0.76) 30 2.4 SB_52772| Best HMM Match : rve (HMM E-Value=0.001) 29 4.3 SB_13699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_11417| Best HMM Match : zf-TAZ (HMM E-Value=0.91) 29 5.6 SB_18635| Best HMM Match : 7tm_1 (HMM E-Value=8.54792e-44) 28 9.9 SB_17819| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 120 bits (290), Expect = 1e-27 Identities = 47/92 (51%), Positives = 71/92 (77%) Frame = +2 Query: 509 SETDADPHNATRGFFFSHIGWLLLRKHPEIKAKGHTVDVNDLRNDPILRFQKKYYQILMP 688 SETDADPHNA RGFFFSH+GWL+ RKHP++ KG +D++DL D ++ FQ+++Y+ + Sbjct: 69 SETDADPHNAKRGFFFSHVGWLMQRKHPDVIRKGKGIDLSDLYADSVVMFQRRHYKKISM 128 Query: 689 LACFIMPTYVPTLWGETVWNSFYVWQFSATYM 784 L C ++PT VP+LWGE++WN+++ F+ Y+ Sbjct: 129 LMCVLIPTLVPSLWGESLWNAYFT-SFALRYV 159 Score = 85.8 bits (203), Expect = 4e-17 Identities = 32/64 (50%), Positives = 48/64 (75%) Frame = +3 Query: 339 LYLCSGLGITAGAHRLWAHKSYKARLPLRILLTIFNTIAFQDAVVDWARDHRMHHKYQRP 518 L LC G G+T GAHRLWAH+++KA+ PLR+++ + N++A Q+ + +W+RDHR+HHKY Sbjct: 12 LSLCRGYGVTIGAHRLWAHRTFKAKWPLRLVIMLMNSMAAQNDIFEWSRDHRVHHKYSET 71 Query: 519 MRTP 530 P Sbjct: 72 DADP 75 >SB_42121| Best HMM Match : EGF_CA (HMM E-Value=8.7) Length = 202 Score = 43.2 bits (97), Expect = 2e-04 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +2 Query: 668 YYQILMPLACFIMPTYVPTLWGETVWNSFYVWQFSATYM 784 +Y+ + L C ++PT VP+LWGE++WN+++ F+ Y+ Sbjct: 2 HYKKISMLMCVLIPTLVPSLWGESLWNAYFT-SFALRYV 39 >SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1252 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 629 DLRNDPILRFQKKYYQILMPL--ACFIMPTYVPTLWGETVWNSFYV 760 D+ N PILR+ +Y + P+ ++ P + TL G WN + + Sbjct: 407 DMPNGPILRYHVTFYDVQTPVQGGTYLAPGTLYTLTGLGPWNEYAI 452 >SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) Length = 1075 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 603 ALISGCFLNNNQPMWEKKNPRVALWGSASVSDICG 499 A++ G F N P WE+ +P L + ++ ICG Sbjct: 548 AIVHGRFSTNTFPSWERAHPNRYLAHNGEINTICG 582 >SB_12261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 631 IIH-VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 527 ++H V G FG DF PAN G E S C VG Sbjct: 339 VVHGVRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 374 >SB_8902| Best HMM Match : DUF1070 (HMM E-Value=0.76) Length = 544 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 631 IIH-VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 527 ++H V G FG DF PAN G E S C VG Sbjct: 305 VVHGVRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 340 >SB_44412| Best HMM Match : DUF1070 (HMM E-Value=0.76) Length = 632 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 631 IIH-VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 527 ++H V G FG DF PAN G E S C VG Sbjct: 541 VVHGVRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 576 >SB_52772| Best HMM Match : rve (HMM E-Value=0.001) Length = 646 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 569 SQCGKRRILGLRCGGPHRSLIFVVHAMITGPIHYGIL 459 + CGK +++ R GP R +I +++ IT P I+ Sbjct: 195 TSCGKTQLVVDRLVGPFRGIIIIINYSITKPFRENIV 231 >SB_13699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/85 (25%), Positives = 32/85 (37%), Gaps = 1/85 (1%) Frame = -2 Query: 397 LCAQSLCAPAVIPNPEHKYKNM-ANIEVLHMALKRNKYPP*TPPTCRIKTESHFSTQSSK 221 +C LC P P H + N+ LH K P R ++H S + + Sbjct: 15 VCQHFLC-PVAQHRPSHIHANLNTRKRTLHAHYTHTKRPI---HDTRSTLDAHTSHYTPR 70 Query: 220 VSSLLREVHGAVHLLAGYWRRLRTI 146 S R H + Y RR+RT+ Sbjct: 71 TSHYTRHTSHYTHRTSHYTRRMRTV 95 >SB_11417| Best HMM Match : zf-TAZ (HMM E-Value=0.91) Length = 390 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 622 VDGMAFGFDFGMLPQQQPANVGKEESSGCVVG 527 V G FG DF PAN G E S C VG Sbjct: 155 VRGGVFGEDFAQHLAPNPANTGDEASYDCGVG 186 >SB_18635| Best HMM Match : 7tm_1 (HMM E-Value=8.54792e-44) Length = 350 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 321 SIFAIFLYLCSGLGITAGAHRLWAHKSY 404 ++F I + LG+++ H WAHK+Y Sbjct: 148 AVFVIIVAWALALGVSSLIHVTWAHKAY 175 >SB_17819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 578 TTTSQCGKRRILGLRCGGPHRSLIFVVHAMITGPIHY 468 TT CG R+L + G H + +++ + PIH+ Sbjct: 35 TTPKHCGILRVLSMDTGTIHARVARILNPELANPIHH 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,740,601 Number of Sequences: 59808 Number of extensions: 694604 Number of successful extensions: 1812 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1811 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -