BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0478 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_35209| Best HMM Match : Ank (HMM E-Value=0) 29 5.3 SB_8286| Best HMM Match : AT_hook (HMM E-Value=0.98) 28 9.3 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/35 (31%), Positives = 25/35 (71%) Frame = +3 Query: 501 NKADVRDFFNVAISTKMSLAYAINILQDFIKITSE 605 N+A+V + F + +S+ + A+ + +LQ+ +K+T+E Sbjct: 2235 NEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNE 2269 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 265 ILNFSSTCKHFNELVNTDQQLWKEKLKE 348 +LN S TC+ F EL LWK+ K+ Sbjct: 36 LLNLSETCRRFKELCFECDTLWKDLCKQ 63 >SB_35209| Best HMM Match : Ank (HMM E-Value=0) Length = 787 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 59 LFTYIRCLKCKFCSVLYNLLAVTSGWSSKSITTTS*DLRKIHIMDEELSIYSLPAEVISI 238 L Y+R + FC ++YN T+ SS I ++ +HI+ L+ + L EV+ I Sbjct: 728 LTVYLRSNEQDFCGIVYN---TTNLCSSSLIVRQDGFVKLLHIVCIVLACFHLSKEVLQI 784 Query: 239 I 241 + Sbjct: 785 V 785 >SB_8286| Best HMM Match : AT_hook (HMM E-Value=0.98) Length = 506 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 196 RTFNIFLTSRSNFYNTEK*CCQEILNFSSTCK 291 R F+I + R +N+E+ C ++ N S CK Sbjct: 19 RLFSIMTSKRHRVFNSEEQICSKLQNVLSLCK 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,337,034 Number of Sequences: 59808 Number of extensions: 399574 Number of successful extensions: 879 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -