BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0475 (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 1.3 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 6.9 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.8 bits (49), Expect = 1.3 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = +1 Query: 346 KKEVDISEIFKSRAPRNKSKKDYSAMLQKRNYTI-SADST---KTLRPNMEIKTEPAAGR 513 KKE +I E +S+ ++ +KD + +K NY S D L+PN +++ + Sbjct: 214 KKEDEIDEGKESKTKLSQWRKDGGTVKKKVNYVYRSVDQVLEDGKLKPNKKVRISNEMSK 273 Query: 514 V 516 V Sbjct: 274 V 274 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 164 GDDVTMTSFDRSTPLRFVLP 105 GDD+ FD+ LR + P Sbjct: 43 GDDIAWMKFDKEGRLRAINP 62 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,286 Number of Sequences: 438 Number of extensions: 3337 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -