BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0474 (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.63 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 4.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 5.9 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.0 bits (52), Expect = 0.63 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -1 Query: 291 GINS-ICWCCPGYSTAGCR 238 GINS IC C PG++ + C+ Sbjct: 41 GINSYICTCKPGFTGSNCQ 59 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 294 PGINSICWCCPGYSTAGC 241 PG+ C C PG++ C Sbjct: 48 PGVGHRCQCQPGFTGKYC 65 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/33 (30%), Positives = 13/33 (39%) Frame = +1 Query: 373 PSSSLTVTSNSEPINSYRPWQSTQRPYFTTTPT 471 P T S P +Y W + Q P +PT Sbjct: 288 PDHIQQATPYSAPGPTYSTWSTVQTPTTVMSPT 320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,898 Number of Sequences: 336 Number of extensions: 4472 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -