BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0474 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 25 0.98 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 2.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.0 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 23 3.9 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.2 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 22 6.9 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 24.6 bits (51), Expect = 0.98 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 224 FLPGRRQPAVEYPGQHQQ 277 ++P R VE+P QHQQ Sbjct: 9 YIPDLRNGGVEHPHQHQQ 26 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/41 (24%), Positives = 16/41 (39%) Frame = +2 Query: 503 PINHNVPGSISGNFNTTISSKWNRSDIAHYRNNRWSTKTHT 625 PI+ N+ G + T W+++ N TK T Sbjct: 272 PIDDNIDDEFKGTYKTLYKQMWSQNITERPTTNEVITKIDT 312 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 341 NHHGQLQVTQILHHH 385 NHH LQ T + HH Sbjct: 146 NHHHHLQSTAVQDHH 160 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 497 IVAFMMCVCVGVVVKYGLCVDCHGRYELIGSE 402 +V F C+CV + L + H E+ +E Sbjct: 5 VVIFAFCICVNAMTIEELKIQLHDVQEICKTE 36 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -2 Query: 680 CLKCI*LRVRIVSLNGLRKCGSWLTICYSCNVRCHSCSTWK 558 CLK + R SL+ ++ + Y N++C CST++ Sbjct: 117 CLKFEEQKRRKKSLDDVKILRNDRIDSYKSNLKCDKCSTYQ 157 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.8 bits (44), Expect = 6.9 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -2 Query: 497 IVAFMMCVCVGVV 459 ++ F +CVCVG + Sbjct: 5 VIIFAICVCVGAM 17 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,928 Number of Sequences: 438 Number of extensions: 5065 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -