BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0473 (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 3.4 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 24 5.9 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.8 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 3.4 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 428 YFYIRNRTSTYERFLNYVHPKGFIDIKTDVVALIMKYLFYCLI 556 YF +RN T E L+ F++I+T + Y FY I Sbjct: 171 YFAVRNSTEPVEHVLHLEEELYFLNIRTSMA----HYTFYVAI 209 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 98 RREIPADFNTVL*SWILFT 42 + E+PADFN L W L T Sbjct: 188 KNELPADFNEWLSRWALET 206 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 92 EIPADFNTVL*SWILFT 42 E+PADFN L W L T Sbjct: 194 EVPADFNQWLNRWALET 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,397 Number of Sequences: 2352 Number of extensions: 14382 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -