BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0473 (766 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43900.1 68414.m05065 protein phosphatase 2C, putative / PP2C... 26 5.3 >At1g43900.1 68414.m05065 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase type 2C GI:4336436 from [Lotus japonicus] Length = 371 Score = 26.2 bits (55), Expect(2) = 5.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 72 IKICRNLSTTVIMCFYTDVNNRLTFAMNSFFFFLF 176 +K RN++++ I C + T + SFFFFLF Sbjct: 1 MKKTRNVASSPIECVHLQTKPTTTL-VRSFFFFLF 34 Score = 20.6 bits (41), Expect(2) = 5.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 237 FL*STSNICFFFLEYFFLCT 296 FL ++ I F + Y FLC+ Sbjct: 32 FLFNSQTISSFIIFYLFLCS 51 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,884,764 Number of Sequences: 28952 Number of extensions: 285986 Number of successful extensions: 554 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -