BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0472 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02760.1 68417.m00376 F-box family protein contains Pfam PF00... 29 3.9 >At4g02760.1 68417.m00376 F-box family protein contains Pfam PF00646: F-box domain; similar to leucine-rich repeats containing F-box protein FBL3 (GI:5919219) [Homo sapiens] Length = 419 Score = 28.7 bits (61), Expect = 3.9 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 2/83 (2%) Frame = -1 Query: 497 IYKSKKILVISKLCLSNC*KL*VIYSLTFKLFIRFHVLFRSLTQQSCICIKLNK--SDVI 324 +YKS K + + L N ++ LT K+F +SL Q S C NK D + Sbjct: 97 LYKSTKRCIRKRATLQNSTSWPLLPELTIKVFSMLDT--KSLMQASACCTMFNKCAMDRV 154 Query: 323 *FSHFSESEPILNVKKGT*IVNI 255 +SH + +V G V I Sbjct: 155 CYSHIDLTTAAEDVDNGVVCVMI 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,572,262 Number of Sequences: 28952 Number of extensions: 236350 Number of successful extensions: 426 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -