BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0471 (758 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067217-2|AAF99977.1| 1887|Caenorhabditis elegans Heavy chain, ... 28 6.3 U97009-12|ABR92602.1| 532|Caenorhabditis elegans Udp-glucuronos... 28 8.3 U97009-11|AAC69026.1| 533|Caenorhabditis elegans Udp-glucuronos... 28 8.3 >AF067217-2|AAF99977.1| 1887|Caenorhabditis elegans Heavy chain, unconventional myosinprotein 7 protein. Length = 1887 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 243 RFHN--V*TYVNIALVLISSFCYFVLLNRRFKRTF 341 RF N + TY+ LV ++ FC+F + N ++ R + Sbjct: 190 RFANGHIYTYIGPILVAVNPFCFFPIYNPKYARLY 224 >U97009-12|ABR92602.1| 532|Caenorhabditis elegans Udp-glucuronosyltransferase protein9, isoform b protein. Length = 532 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 231 VKYQNRLPNGISIECSWVESRNMSSVTKIKLI*FH 127 VK+QNRLP + ++ WV ++ + ++KL H Sbjct: 345 VKFQNRLPKNVHLK-KWVPQPSLLADKRVKLFVTH 378 >U97009-11|AAC69026.1| 533|Caenorhabditis elegans Udp-glucuronosyltransferase protein9, isoform a protein. Length = 533 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 231 VKYQNRLPNGISIECSWVESRNMSSVTKIKLI*FH 127 VK+QNRLP + ++ WV ++ + ++KL H Sbjct: 346 VKFQNRLPKNVHLK-KWVPQPSLLADKRVKLFVTH 379 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,266,038 Number of Sequences: 27780 Number of extensions: 267803 Number of successful extensions: 515 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -