BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0471 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62670.1 68416.m07040 two-component responsive regulator fami... 29 2.5 At5g14520.1 68418.m01702 pescadillo-related similar to pescadill... 28 7.7 >At3g62670.1 68416.m07040 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 426 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = -3 Query: 372 SPRNIYLIIPEMFV*TSCLITRNNKNYL*VLVQYLRTFKH-CEI*DQSVKYQNRLPNGIS 196 +PR Y + + TSCL NN ++ Y+ F+H + Q +YQ+ L N IS Sbjct: 317 APRGSYFMNNIPYPSTSCLPVNNNNCFMTNPSTYIDQFQHQLQQQQQHQQYQSTL-NSIS 375 Query: 195 IECSWVESRNMSS 157 + ESR++ S Sbjct: 376 AMLTKQESRHVPS 388 >At5g14520.1 68418.m01702 pescadillo-related similar to pescadillo [Zebrafish, Danio rerio] SWISS-PROT:P79741 Length = 590 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 168 SWIRPKSIRSIFRLAIDFDT*LTDLRFH-NV*TYVNIALVLISSFCYFVLLNRRFK 332 +W+ P +I+ +F +DF LT L F+ + ++N L + Y +L+ R + Sbjct: 199 TWLTPHAIQQVFTNDVDFGVLLTFLEFYETLLAFINFKLYHSLNVKYPPILDSRLE 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,692,228 Number of Sequences: 28952 Number of extensions: 221385 Number of successful extensions: 363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -