BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0468 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0342 - 2691294-2691441,2691589-2691667,2691737-2691799,269... 30 1.7 07_03_0224 + 15385572-15385747,15386311-15386383,15387310-153876... 28 9.3 >05_01_0342 - 2691294-2691441,2691589-2691667,2691737-2691799, 2692852-2692917,2694939-2695004,2695194-2695283, 2695376-2695463,2695552-2695629,2695732-2695824, 2695907-2696024,2696418-2696539,2696633-2696930, 2697645-2697649 Length = 437 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 668 IKRIKEGSIVSRIPHIEVGDHIEKLNGENM 757 +K + EGSI+ ++ + +GD IE LNGE + Sbjct: 179 VKEVSEGSILEKLG-VRIGDIIECLNGERI 207 >07_03_0224 + 15385572-15385747,15386311-15386383,15387310-15387658, 15387814-15387860,15387948-15388025,15388328-15388398, 15388514-15388601 Length = 293 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +2 Query: 593 KEIEIVKTEDALGLTITD----NGAGYAFIKRIKEGSIVSRIP 709 + +EI+ +E + + ITD GY +K+IKE S + +IP Sbjct: 208 RALEILGSEPNVSMIITDYWMPEMTGYDLLKKIKESSELKQIP 250 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,844,852 Number of Sequences: 37544 Number of extensions: 367725 Number of successful extensions: 754 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -