BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0468 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 36 0.002 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 3.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 4.5 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 7.8 AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding pr... 23 7.8 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 35.5 bits (78), Expect = 0.002 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 614 TEDALGLTITDNGAGYAFIKRIKEGSIVSRIPHIEVGDHIEKLNGE 751 T++ +G+T+ G + RI G ++ R + VGD I ++NG+ Sbjct: 483 TDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEIREINGQ 528 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 578 RKGRPKEIEIVKTEDALGLTITDNGAGYAFIKR 676 R+ + E+++ + LGL+I +NG+ FI R Sbjct: 134 RRNNLRGEELLQMVEVLGLSILNNGSAPTFIGR 166 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +2 Query: 533 LLGGQIGLEDFIFAHRKGRPKEIEIVKTEDALGLTITDNGAGYAF 667 LL G + + +PK I +++ + LGL + + G + F Sbjct: 117 LLAGDFNAWHTAWGSERTKPKGIALLQLVNGLGLEVLNIGTSHTF 161 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 14 AYVVEFKVYSLTEHHNIII 70 +Y+V K+Y TEH N+ I Sbjct: 389 SYIVRVKIYLETEHTNMNI 407 >AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding protein AgamOBP51 protein. Length = 176 Score = 23.4 bits (48), Expect = 7.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 579 LCAKIKSSNPICPP 538 LC K++S +CPP Sbjct: 163 LCEKVRSGVAVCPP 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,821 Number of Sequences: 2352 Number of extensions: 16232 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -