BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0467 (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27905| Best HMM Match : MyTH4 (HMM E-Value=0.014) 29 4.2 SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 >SB_27905| Best HMM Match : MyTH4 (HMM E-Value=0.014) Length = 478 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 243 RCDNCSVRR--HSHLKWI*DQARLNNCTVPLAVCNVIPNFLDVLHIFVK 103 RCDN HS +K+I R++ PL C ++P F+ L F+K Sbjct: 23 RCDNLRYDHVNHSRIKYI-TFTRISTLK-PLTPCRLVPQFVKYLWCFIK 69 >SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2408 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -3 Query: 180 LNNCTVPLAVCNVIPNFLDVLHIFVKVY 97 L++CTVPL+ C V+ +L+ IFV +Y Sbjct: 1644 LSDCTVPLSACTVLLLYLN--RIFVGLY 1669 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,802,546 Number of Sequences: 59808 Number of extensions: 427526 Number of successful extensions: 917 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -