BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0467 (779 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34412.1 68417.m04888 expressed protein 33 0.16 At1g11170.2 68414.m01279 expressed protein contains Pfam profile... 28 8.0 >At4g34412.1 68417.m04888 expressed protein Length = 143 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +3 Query: 261 TRTVFGEILYNLSLTKNITQSLSKFGIEKS 350 TRT+ E++YN S +K+IT+SL + GI ++ Sbjct: 71 TRTLHSELVYNYSGSKHITESLKRCGISEN 100 >At1g11170.2 68414.m01279 expressed protein contains Pfam profile PF05212: Protein of unknown function (DUF707) Length = 335 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 206 KWLWRRTEQLSQRNLVHGYANCVRRNFVQFIAYQKYNTKFKQVWNRKK 349 K W T L Q +LVHG+ ++ + + + YN++F N K+ Sbjct: 284 KAAWLCTWNLIQNDLVHGWGMDMKLGYCAQVTFFLYNSRFCGRPNEKR 331 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,401,767 Number of Sequences: 28952 Number of extensions: 297780 Number of successful extensions: 729 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1746037600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -