BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0465 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 25 0.72 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.2 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 6.7 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 8.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.9 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 8.9 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.0 bits (52), Expect = 0.72 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 444 KKNHSNVIST*QMFTIDFHGERITSCNKN--HISHDYNLRNYLGRLVTPHG 298 K NH+ + T + E I N + +++HDYNL N L + G Sbjct: 178 KANHALIFGKLDTKTSGKYKEYIIPANYSGWYLNHDYNLENKLNYFIEDIG 228 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 444 KKNHSNVIST*QMFTIDFHGERITSCNKN--HISHDYNLRNYL 322 K NH+ + T + E I N + +++HDYNL N L Sbjct: 178 KANHALIFGKLDTKTSGKYKEYIIPANYSGWYLNHDYNLENKL 220 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.4 bits (48), Expect = 2.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 324 SNYANYNHARYDFYYTMLFF 383 +NY NYN+ Y+ Y L++ Sbjct: 328 NNYNNYNNNNYNNYNKKLYY 347 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 324 SNYANYNHARYDFYY 368 SNY NYN+ YY Sbjct: 92 SNYNNYNNYNKKLYY 106 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -3 Query: 676 LFCYIFFYCLDVWTS 632 L C++ F+C+++ TS Sbjct: 282 LICWVPFFCVNIVTS 296 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 494 NHLTPDRVCARPP 456 NH P+R C PP Sbjct: 1693 NHCAPNRRCPPPP 1705 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 324 SNYANYNHARYDFYYTMLF 380 +NY NYN+ Y+ Y + + Sbjct: 336 NNYNNYNNNNYNNYKKLYY 354 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 318 ALSNYANYNHARYDFYY 368 +LSN NYN+ Y + Y Sbjct: 317 SLSNNYNYNNNNYKYNY 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,356 Number of Sequences: 438 Number of extensions: 4571 Number of successful extensions: 19 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -