BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0464 (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 32 0.059 SPAC167.04 |pam17||presequence translocase-associated motor subu... 26 5.1 SPAC1952.08c |||pyridoxamine 5'-phosphate oxidase |Schizosacchar... 25 8.9 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 32.3 bits (70), Expect = 0.059 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 382 EFEFRIVHENKISIHLEFYSFLNME*TLKEDRVAVIALHRCG 257 +F+FR+ HEN +SIH+ +N E K + A+ L G Sbjct: 165 QFQFRVGHENFVSIHVSLVPVINGEQKTKPTQQAIRDLRSLG 206 >SPAC167.04 |pam17||presequence translocase-associated motor subunit Pam17 |Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 441 KYCHTVKTFLLECWPQKSLLNSNFELFMKIK 349 K C+ VKT+ E QK + N+ F+K++ Sbjct: 25 KTCYNVKTYSTESIKQKKPQDLNWPTFLKLR 55 >SPAC1952.08c |||pyridoxamine 5'-phosphate oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 190 Score = 25.0 bits (52), Expect = 8.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 69 FGISLNSRLHSFYHCWSPNRPRATTS*PVIYTRVF 173 F IS N R+ H W+ NR +YT ++ Sbjct: 71 FNISSNPRVSLLVHDWTTNRQETDPDASSLYTLLY 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,303,783 Number of Sequences: 5004 Number of extensions: 43132 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -