BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0464 (624 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69634-3|CAA93454.4| 553|Caenorhabditis elegans Hypothetical pr... 30 1.2 Z70213-1|CAA94175.1| 1354|Caenorhabditis elegans Hypothetical pr... 28 4.7 >Z69634-3|CAA93454.4| 553|Caenorhabditis elegans Hypothetical protein B0001.5 protein. Length = 553 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 75 ISLNSRLHSFYHCWSPNRPRAT 140 I+ +++L FY WSP+RPR+T Sbjct: 171 ITTHAKLGDFYLVWSPSRPRST 192 >Z70213-1|CAA94175.1| 1354|Caenorhabditis elegans Hypothetical protein ZK930.1 protein. Length = 1354 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 132 RATTS*PVIYTRVFIVSFDGTINESFGYIQICQYVKNLNWR*PQRCNAITATRSSLS 302 R T+ P Y+ V +FD +NE ++ +++N+N R P+R A +A+ LS Sbjct: 886 RTVTNTPAPYSPVKNTTFDNQVNEMLAHLNEL-HMRNVNCR-PKRPLAASASHPVLS 940 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,463,811 Number of Sequences: 27780 Number of extensions: 233695 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1363963182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -