BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0463 (708 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0904 + 25832026-25832643 36 0.024 07_03_1627 + 28229292-28229615,28229735-28229812,28231105-282311... 29 4.8 >06_03_0904 + 25832026-25832643 Length = 205 Score = 36.3 bits (80), Expect = 0.024 Identities = 18/52 (34%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 3 DVDNLLQQVADEAGLELNMELP-SGVPSTSIGTATVVSQEQDELTQRLARLR 155 +V++L+QQVAD+ GLE+++ LP + + + ++D+L++RLA L+ Sbjct: 151 EVNSLMQQVADDYGLEVSVGLPQAAAHAIPAAKEKEKAVDEDDLSRRLAELK 202 >07_03_1627 + 28229292-28229615,28229735-28229812,28231105-28231164, 28231750-28232040,28232149-28232277 Length = 293 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 98 RNCCFPRTRRTHTETCQVETS 160 RNCC PR + T T++C++ T+ Sbjct: 37 RNCCLPRLKTT-TQSCRITTA 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,523,630 Number of Sequences: 37544 Number of extensions: 281399 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -