BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0463 (708 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17730.1 68414.m02195 SNF7 family protein contains Pfam domai... 44 8e-05 At1g73030.1 68414.m08445 SNF7 family protein contains Pfam domai... 42 5e-04 >At1g17730.1 68414.m02195 SNF7 family protein contains Pfam domain, PF03357: SNF7 family Length = 203 Score = 44.4 bits (100), Expect = 8e-05 Identities = 23/51 (45%), Positives = 36/51 (70%) Frame = +3 Query: 3 DVDNLLQQVADEAGLELNMELPSGVPSTSIGTATVVSQEQDELTQRLARLR 155 +V++L+QQVAD+ GLE+++ LP +I T T E+D+LT+RLA L+ Sbjct: 151 EVNSLMQQVADDYGLEVSVGLPQPA-GHAIPTKTEEKVEEDDLTRRLAELK 200 >At1g73030.1 68414.m08445 SNF7 family protein contains Pfam domain, PF03357: SNF7 family Length = 203 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/51 (41%), Positives = 36/51 (70%) Frame = +3 Query: 3 DVDNLLQQVADEAGLELNMELPSGVPSTSIGTATVVSQEQDELTQRLARLR 155 +V++L+QQVAD+ GLE+++ LP +I T T ++D+L++RLA L+ Sbjct: 151 EVNSLMQQVADDYGLEVSVGLPQPA-GHAIPTKTEEKVDEDDLSRRLAELK 200 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,597,728 Number of Sequences: 28952 Number of extensions: 258596 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -