BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0461 (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) 84 1e-16 >SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) Length = 108 Score = 83.8 bits (198), Expect = 1e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 517 RKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAIT 642 RKSEIEYYA+LAKTGVHHY+GNNIELGTACGKY+RV L+IT Sbjct: 46 RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVSVLSIT 87 Score = 76.6 bits (180), Expect = 2e-14 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +1 Query: 58 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 195 +ESINSRLALVMKSGK+ LG K TLKTLRQGKAKLVIIA N P LR Sbjct: 1 MESINSRLALVMKSGKFTLGLKSTLKTLRQGKAKLVIIANNTPQLR 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,471,795 Number of Sequences: 59808 Number of extensions: 365719 Number of successful extensions: 828 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -